Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MCEFISEYSEFQYDFISLAQQRFVSVPEIDLRTMIQNFGDWYFANESSSLN-TPSIWLVKWFSWVQNNEKQ-----VAANRKKQEQITSTCQKPQESGYFANLFEEQSESQIVDVTPAKKFPMIEEVGHA 2PBX Chain:A ((73-152)) ----VRQYSNFLTDHIDL---------DLDVKTNLQTL-----CKEMVKLAMTDCHWLKVWFEWSASTRDEVWPLFVSTNRTNQLLIRNMFMKAMERG--------------------------------

General information: TITO was launched using: RESULT: Template: 2PBX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 165 -4771 -28.91 -64.47 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -28.91 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.303

(partial model without unconserved sides chains): PDB file : Tito_2PBX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PBX-query.scw PDB file : Tito_Scwrl_2PBX.pdb: