Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFQGYSKDRREETCSYCGAIYIVDIPGLPGHEEREEYFCPECSHVNFARASNSPRVSLVKARTDGKNDKSPSFQALIDSYKDE 4QIW Chain:W ((8-48)) -------------CAKCGKEVELDLA------TAREVRCPYCGSKILYK-PRPRVARRVKA----------------------

General information: TITO was launched using: RESULT: Template: 4QIW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 90 -15394 -171.04 -375.45 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain W : 0.66 3D Compatibility (PKB) : -171.04 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.660

(partial model without unconserved sides chains): PDB file : Tito_4QIW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4QIW-query.scw PDB file : Tito_Scwrl_4QIW.pdb: