Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTDINDYEDAEDSAVDEDEAKAAESGAADEE----AGNLTDADLAEAETLT-----------VTAKQKQRQALEDEVAAFLARG---GRITEVPPDEHSDR--
4G6V Chain:B ((2-104))AIDLFCYLSIDRGAAESDLNKIRSNHSELFEGKFLISPVRDADFSLKEIAAEHGLVAESFFLVSLNDKNSADLIPIVSKILVDGFNGGAILILQDNEYRRTSL


General information:
TITO was launched using:
RESULT:

Template: 4G6V.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 283 13749 48.58 165.64
target 2D structure prediction score : 0.51
Monomeric hydrophicity matching model chain B : 0.63

3D Compatibility (PKB) : 48.58
2D Compatibility (Sec. Struct. Predict.) : 0.51
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.476

(partial model without unconserved sides chains):
PDB file : Tito_4G6V.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4G6V-query.scw
PDB file : Tito_Scwrl_4G6V.pdb: