Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------MLETLLQAILEQIDEPKKDLEKNLRALLNETV-EKLDLVSKQEIERQKTALHLANQRLEALQKQVSLLEEALKNKK 2LW1 Chain:A ((551-635)) KAETVKRSSSKLSYKLQRELEQLPQLLEDLEAKLEALQTQVADASFFSQPHEQTQKVLADMAAAEQELEQAFERWEYLEALKNGG-

General information: TITO was launched using: RESULT: Template: 2LW1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 133 15369 115.56 207.69 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : 115.56 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.754

(partial model without unconserved sides chains): PDB file : Tito_2LW1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LW1-query.scw PDB file : Tito_Scwrl_2LW1.pdb: