Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIFTVSLHFARTVFNMRDIRCKRGCIMKKLFTILALCITVLTTSMASFADPPFDRGHGPKGPKGGPRGEWNDRGHKFDRDDNGDRVRDERRMREERGFERLKQHRWQPGYVMPQHYRGNGYKV-DYKDNNLPKPDRNQQWYKINNDYILVDTDSNSIVSICGF------ 2L1S Chain:A ((1-83)) --------------------------------------------------------------------------------------GAAGIDQYALKEFTADFTQFHIGDTVPAMYLTPEYNIKQWQQRNLPAPDAGSHWTYMGGNYVLITDTEGKILKVYDGEIFYHR

General information: TITO was launched using: RESULT: Template: 2L1S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 299 -11776 -39.38 -154.95 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -39.38 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.529

(partial model without unconserved sides chains): PDB file : Tito_2L1S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L1S-query.scw PDB file : Tito_Scwrl_2L1S.pdb: