Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRVLSKPQRKTQYNLRIDQELHEWLKEVAAKNERPVNYVINQAIKNMRKEIEGAKA 2AY0 Chain:C ((2-45)) --------GTTTMGVMLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLE----

General information: TITO was launched using: RESULT: Template: 2AY0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 55 -12405 -225.54 -281.92 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain C : 0.72 3D Compatibility (PKB) : -225.54 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.752

(partial model without unconserved sides chains): PDB file : Tito_2AY0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AY0-query.scw PDB file : Tito_Scwrl_2AY0.pdb: