Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPRSLKKGPFVDAHLFAKVEAAVASNSRKPIKTWSRRSMILPDFVGLTISVHNGRNHVPVIVTEHMVGHKLGEFAPTRTYRGHGVDKKSKR 5ME0 Chain:S ((3-81)) --RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYR----------

General information: TITO was launched using: RESULT: Template: 5ME0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 293 -46559 -158.90 -589.35 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain S : 0.92 3D Compatibility (PKB) : -158.90 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.92 QMean score : 0.719

(partial model without unconserved sides chains): PDB file : Tito_5ME0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5ME0-query.scw PDB file : Tito_Scwrl_5ME0.pdb: