Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQLLSALAQAT----DEDVIKGIKKVLISRGYSRKELNELTQKTSIH 3D36 Chain:C ((5-41)) -------------------------------SDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHK------------

General information: TITO was launched using: RESULT: Template: 3D36.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 44 -3187 -72.42 -96.56 target 2D structure prediction score : 0.94 Monomeric hydrophicity matching model chain C : 0.70 3D Compatibility (PKB) : -72.42 2D Compatibility (Sec. Struct. Predict.) : 0.94 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.972

(partial model without unconserved sides chains): PDB file : Tito_3D36.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3D36-query.scw PDB file : Tito_Scwrl_3D36.pdb: