Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLMSNHLIKHFQKGKRMQLATKSFLGLCLICSTAGAVEPAATPATPPTAASTQNAKPAPTSATVAKPATTTAPTTTQPLTAEQIAKNKQQQDAKIKALVQDQASRLKQLEHANLEALAQNQELQLKNDNLSVQVQVLQSERSAQMFLYGAVTLAGGVLLGFFIASYVYTKRRRQW 4W7Z Chain:A ((1-64)) --------------------------------------------------------------------------------SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL-------------------------------

General information: TITO was launched using: RESULT: Template: 4W7Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 6 -1390 -231.58 -21.71 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -231.58 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.736

(partial model without unconserved sides chains): PDB file : Tito_4W7Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4W7Z-query.scw PDB file : Tito_Scwrl_4W7Z.pdb: