Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNAKVNNKTMDWSKLSAHQWLEQYGLWVRSTKSKVSANPLACLIDQNDTTRIRSSKVSMPCEIEDYEAVEVSKLLAAMHNDEREFLQERAWLLILKYENDWSYRTIANTHGVGKDTVRKEIDKGLAYLDGKIEALAEFDNEKKSR 5FGM Chain:A ((143-203)) -----------------------------------------------------------------LPDSDVKQALQAIP-------EEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLE------------

General information: TITO was launched using: RESULT: Template: 5FGM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 201 -32065 -159.53 -525.66 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -159.53 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.689

(partial model without unconserved sides chains): PDB file : Tito_5FGM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FGM-query.scw PDB file : Tito_Scwrl_5FGM.pdb: