Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSRVCEMKYYVSIVQEEGAYIVSSRDLPLLNSVGYTLEEALSEALDGIETTFEIYMDERKAIPLPSKGKKDEYEIHLPVRVAAKVRLYNEMISQDVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFHALGKDLDIVVA 2W48 Chain:A ((6-46)) -------------------------------------------------------------------------DIRLIVKIA---QLYYE---QDMTQAQIARELGIYRTTISRLL---------------------------

General information: TITO was launched using: RESULT: Template: 2W48.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 99 -21901 -221.22 -591.92 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -221.22 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.729

(partial model without unconserved sides chains): PDB file : Tito_2W48.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2W48-query.scw PDB file : Tito_Scwrl_2W48.pdb: