Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------MIEVTDTAVTSFDDAAEGIEQSRTDGKGLNESHAKGCKN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 5FTW Chain:A ((2-256)) DTYSVFTTKWKQLTGVDLTLYKEAQMKRRLTSLYEKKGFQSFKDFAAALEK---DQALLNETLDRMTINVSEFYRNYKRWEVLETAILPLIKTSRPLKIWSAACSTGEEPYTLAMLLDQQKGLPGYQILATDIDEKALEKAKKGVYQERSLQEVPLSVKDRYFTQNANRSYEVKTEIKKNITFKKHNLLADRYEQDFDLIVCRNVFIYFTESAKEELYLKMAHSLKKNGVLFVGSTEQIFNPEKFGLVPADTFFYQKR

General information: TITO was launched using: RESULT: Template: 5FTW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 59 5657 95.87 157.13 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : 95.87 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.572

(partial model without unconserved sides chains): PDB file : Tito_5FTW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FTW-query.scw PDB file : Tito_Scwrl_5FTW.pdb: