Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-MLVFPAKYHLFKKKILEYMFGKL---YLKNHPLQKK----DMIPLF--
1T0F Chain:C ((4-52))IKVVKPSDWDSLPDTDLRYIYSQRQPEKTMHERLKGKGVIVDMASLFKQ


General information:
TITO was launched using:
RESULT:

Template: 1T0F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 77 1231 15.98 31.55
target 2D structure prediction score : 0.49
Monomeric hydrophicity matching model chain C : 0.70

3D Compatibility (PKB) : 15.98
2D Compatibility (Sec. Struct. Predict.) : 0.49
1D Compatibility (Hydrophobicity) : 0.70
QMean score : 0.341

(partial model without unconserved sides chains):
PDB file : Tito_1T0F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1T0F-query.scw
PDB file : Tito_Scwrl_1T0F.pdb: