Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKLIVLGGLIYGGYWLYKYMLAHPNIDKGKVIKTVGVIIVGLIALTKKNNTNSPKIMRTYRCRGCGREISTSFNPSESPQGRDRCHTGYRHYWERID 2N3G Chain:A ((1-72)) MDHV-------------YKGQLQAYALQHNLELPVY--------ANEREGPPHAPRFRCNVTF--CGQTFQSS---EFFPTLKSAEHAAAKIAVASLT

General information: TITO was launched using: RESULT: Template: 2N3G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 264 -16362 -61.98 -227.24 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -61.98 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.274

(partial model without unconserved sides chains): PDB file : Tito_2N3G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2N3G-query.scw PDB file : Tito_Scwrl_2N3G.pdb: