Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKGESMKTTLVLFYKKHPYFTLLINILLASVIGISVEYLINKDFIGSCFYTALFLGLLEAFSIYKKSKK 2BBY Chain:A ((185-199)) --------DMLFSAFEKHQYYNL-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 2BBY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 6 -2364 -394.00 -157.60 target 2D structure prediction score : 0.20 Monomeric hydrophicity matching model chain A : 0.48 3D Compatibility (PKB) : -394.00 2D Compatibility (Sec. Struct. Predict.) : 0.20 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.675

(partial model without unconserved sides chains): PDB file : Tito_2BBY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2BBY-query.scw PDB file : Tito_Scwrl_2BBY.pdb: