Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------------------MYGKIKQVKEGSFGSLTVLMTGETKELDQAEVFIKEQGVGIEVIHRG 2QSW Chain:A ((11-100)) LVVEEMLEQYPNGKIVRLLFHGEQAKLPIISHIVQEYQVEVSIIQGNIQQTKQGAVGSLYIQLLGEEQNILAAIEGLRKLRVETEVIGNE

General information: TITO was launched using: RESULT: Template: 2QSW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 72 -1824 -25.33 -38.81 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -25.33 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.418

(partial model without unconserved sides chains): PDB file : Tito_2QSW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QSW-query.scw PDB file : Tito_Scwrl_2QSW.pdb: