Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMPNIESAIKRVRTSENANVKNSSQTSAMRTAIKKFEDAVASG-ADNVDALYKEAVKAIDMAESKGLIHKNKANRDKSRLSKKIAK
5O5J Chain:T ((2-85))-ANIKSQIKRIRTNERRRLRNQSVKSSLRTAIRGFREAVDAGDKDKASELLHATSRKLDKAASKGVIHPNQAANKKSALALALNK


General information:
TITO was launched using:
RESULT:

Template: 5O5J.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 181 5995 33.12 72.23
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain T : 0.84

3D Compatibility (PKB) : 33.12
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.694

(partial model without unconserved sides chains):
PDB file : Tito_5O5J.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5O5J-query.scw
PDB file : Tito_Scwrl_5O5J.pdb: