Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGYDKHQARTSGWRVPENNLIFVSLLGGGLGGLISRKVFHHKTRKKKFTIGFAAGVLVDLILIYFFH 5BR6 Chain:D ((12-31)) --------------------------GGWTGMIDGWYGYHHENSQG---------------------

General information: TITO was launched using: RESULT: Template: 5BR6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 12 -402 -33.46 -20.08 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain D : 0.47 3D Compatibility (PKB) : -33.46 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.47 QMean score : 0.567

(partial model without unconserved sides chains): PDB file : Tito_5BR6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5BR6-query.scw PDB file : Tito_Scwrl_5BR6.pdb: