Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNNSYHFDQNCDWHGVNVHVQLPSFHVFS 4BC2 Chain:A ((9-33)) RRCCLGWDFSTQQVKVVAVDAELNV-----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4BC2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 45 -10315 -229.22 -412.60 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -229.22 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.788

(partial model without unconserved sides chains): PDB file : Tito_4BC2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BC2-query.scw PDB file : Tito_Scwrl_4BC2.pdb: