Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFKKTTRSIVTIIFQILFLGNNRHFLRLLGKKKPKIEHSLETLLRELLLLFPYIKAETDNISFLPFLHQIVFATSYTTLIFYKSQHFLAFLLLFRNIFLMFSILCFQLSDNS 5VJC Chain:A ((140-171)) ------------------------HLLLKIGDPKDAVRNGVRRVLRQVILVFPFVK---------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5VJC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 39 -8309 -213.04 -259.64 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -213.04 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.732

(partial model without unconserved sides chains): PDB file : Tito_5VJC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5VJC-query.scw PDB file : Tito_Scwrl_5VJC.pdb: