Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKMKKYKIRKSGNSDVTTIPPEVKEFMGVQTGDAISYVFQSDGSVRMIKAQEEPDIDSLVDSIMNQYEDALKDLVDL 1MVF Chain:E ((4-47)) ------SSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLV-DGKLIIEPV---------------------------

General information: TITO was launched using: RESULT: Template: 1MVF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 75 -10186 -135.81 -231.50 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain E : 0.64 3D Compatibility (PKB) : -135.81 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.748

(partial model without unconserved sides chains): PDB file : Tito_1MVF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1MVF-query.scw PDB file : Tito_Scwrl_1MVF.pdb: