Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQGIADIKIIKEILE--KSTANAIAFGTGINLSTVKKLKSGERAEEKLNLADAIKITEFGMKNMPTKIEIWK 4J1X Chain:C ((8-65)) ----TGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEG--GELTLTQLGRIAHVLGTS---------

General information: TITO was launched using: RESULT: Template: 4J1X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 163 8864 54.38 158.28 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain C : 0.67 3D Compatibility (PKB) : 54.38 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.709

(partial model without unconserved sides chains): PDB file : Tito_4J1X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4J1X-query.scw PDB file : Tito_Scwrl_4J1X.pdb: