Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEEQILSILEEITGTDEVRKNRDIDLFDEGLLDSLASVQLLVELDGELDIQVPVSEFEREDWSTPNKIIQQATALKG 4BPH Chain:A ((3-78)) FKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELK-

General information: TITO was launched using: RESULT: Template: 4BPH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -48118 -170.63 -633.13 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 0.89 3D Compatibility (PKB) : -170.63 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.89 QMean score : 0.709

(partial model without unconserved sides chains): PDB file : Tito_4BPH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BPH-query.scw PDB file : Tito_Scwrl_4BPH.pdb: