Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----MEKTVSAKIEDLKLDILKQAKVAMEHAVDKEDSAMVAAIAEILAHV------- 3FXD Chain:B ((29-86)) VTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ

General information: TITO was launched using: RESULT: Template: 3FXD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 63 810 12.86 17.61 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : 12.86 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.726

(partial model without unconserved sides chains): PDB file : Tito_3FXD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FXD-query.scw PDB file : Tito_Scwrl_3FXD.pdb: