@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00089_TRY1_B: (2014-08-23 )
FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN

Atome Classification :

(55 SA) .........10........20........30........---40.--........50........60.--.......70......-..80........90.....-...100.......110.......120.......130.......140.......150.......160.......170..-.....180.......190.......200.......210..-.-....220.......230.......240.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
52 PsiBlast_CBE 98.16100%-120 - C1 -4AB9 TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
57 PsiBlast_CBE 98.09100%-120 - C1 -3T26 TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
5 PsiBlast_PDB 97.99100%-117 - C1 -2BY6 TRY1_BOVIN X:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
62 PsiBlast_CBE 97.95100%-119 - C1 -3RXS TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
42 PsiBlast_CBE 97.95100%-120 - C1 -4AOQ TRY1_BOVIN B:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
56 PsiBlast_CBE 97.93100%-118 - C1 -3T27 TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
68 PsiBlast_CBE 97.92100%-119 - C1 -3RXL TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
7 PsiBlast_PDB 97.88100%-118 - C1 -2BY8 TRY1_BOVIN X:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
66 PsiBlast_CBE 97.79100%-118 - C1 -3RXO TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
51 PsiBlast_CBE 97.71100%-119 - C1 -4ABA TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
46 PsiBlast_CBE 97.70100%-117 - C1 -4ABH TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
6 PsiBlast_PDB 97.69100%-117 - C1 -2BY7 TRY1_BOVIN X:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
3 PsiBlast_PDB 97.67100%-118 - C1 -1LQE TRY1_BOVIN A:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
58 PsiBlast_CBE 97.66100%-116 - C1 -3T25 TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
70 PsiBlast_CBE 97.64100%-119 - C1 -3RXJ TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
2 PsiBlast_PDB 97.64100%-118 - C1 -1F0U TRY1_BOVIN A:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
59 PsiBlast_CBE 97.59100%-120 - C1 -3RXV TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
39 PsiBlast_CBE 97.58100%-117 - C1 -4AOR TRY1_BOVIN B:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
50 PsiBlast_CBE 97.57100%-118 - C1 -4ABB TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
4 PsiBlast_PDB 97.56100%-117 - C1 -2BY5 TRY1_BOVIN X:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
65 PsiBlast_CBE 97.50100%-117 - C1 -3RXP TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
34 PsiBlast_CBE 97.50100%-117 - C1 -4I8J TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
9 PsiBlast_PDB 97.50100%-117 - C1 -2BYA TRY1_BOVIN X:[21-243] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
54 PsiBlast_CBE 97.48100%-118 - C1 -3T29 TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
64 PsiBlast_CBE 97.40100%-118 - C1 -3RXQ TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
48 PsiBlast_CBE 97.40100%-117 - C1 -4ABE TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
61 PsiBlast_CBE 97.38100%-117 - C1 -3RXT TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
38 PsiBlast_CBE 97.38100%-116 - C1 -4AOR TRY1_BOVIN C:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
53 PsiBlast_CBE 97.35100%-119 - C1 -3VPK TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN
47 PsiBlast_CBE 97.31100%-117 - C1 -4ABF TRY1_BOVIN A:[1-223] --------------------IVGGYTCGANTVPYQVSLN---S-G--YHFCGGSLINSQWVVSAAHCY--KSGIQVRLGEDNINV-VEGNEQFISASKSIVHPSY-NSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG-QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWG-S-GCAQKNKPGVYTKVCNYVSWIKQTIASN