@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00248_AK1C1_: (2014-09-03 )
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Atome Classification :

(52 SA) .........10........20....-....30........40........50........60........-70---........80........90........100.......110.......120...--------..--..130.......140........150..---.....160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.----......270.......280.......290.......-300--....---------...310....-...320.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
13 PsiBlast_CBE 98.6697%-113 - C8 -2IPJ AK1C2_HUMAN B:[1-321] --SKYQCVKLNDGHFMPVLGFGTAA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
14 PsiBlast_CBE 98.4997%-112 - C8 -2IPJ AK1C2_HUMAN A:[1-321] --SKYQCVKLNDGHFMPVLGFGTAA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
12 PsiBlast_CBE 98.3597%-116 - C8 -1J96 AK1C2_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
6 PsiBlast_CBE 97.9997%-113 - C8 -2HDJ AK1C2_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
5 PsiBlast_CBE 97.7997%-112 - C8 -2HDJ AK1C2_HUMAN B:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
2 PsiBlast_PDB 97.74100%-112 - C8 -1MRQ AK1C1_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
10 PsiBlast_CBE 97.6697%-114 - C8 -1XJB AK1C2_HUMAN A:[4-325] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
4 PsiBlast_CBE 97.57100%-112 - C8 -3C3U AK1C1_HUMAN A:[4-323] ---KYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
9 PsiBlast_CBE 97.5697%-112 - C8 -1XJB AK1C2_HUMAN B:[4-325] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
3 PsiBlast_CBE 97.44100%-113 - C8 -3NTY AK1C1_HUMAN A:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
11 PsiBlast_CBE 97.3697%-116 - C8 -1J96 AK1C2_HUMAN B:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIP-----KILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
1 PsiBlast_PDB 97.2099%-116 - C8 -3GUG AK1C1_HUMAN A:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TVDIFAGPPN-YPFSDEY
8 PsiBlast_CBE 96.6297%-109 - C8 -1IHI AK1C2_HUMAN A:[3-322] --SKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDE-
7 PsiBlast_CBE 96.3997%-107 - C8 -1IHI AK1C2_HUMAN B:[3-322] --SKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDE-
34 PsiBlast_CBE 94.0087%-110 - C8 -4DBU AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYS---
41 PsiBlast_CBE 93.6287%-111 - C8 -1RY8 AK1C3_HUMAN B:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
42 PsiBlast_CBE 93.6187%-110 - C8 -1RY8 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
35 PsiBlast_CBE 93.5487%-111 - C8 -4DBS AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
38 PsiBlast_CBE 93.4287%-109 - C8 -2F38 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
40 PsiBlast_CBE 93.3187%-113 - C8 -1XF0 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPE---SKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
33 PsiBlast_CBE 93.2487%-105 - C8 -4DBU AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
31 PsiBlast_CBE 93.0587%-110 - C8 -4DBW AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
18 PsiBlast_CBE 92.9987%-109 - C8 -4FAM AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYS---
39 PsiBlast_CBE 92.9787%-113 - C8 -1ZQ5 AK1C3_HUMAN A:[5-321] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSP---NGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSD--
36 PsiBlast_CBE 92.7887%-111 - C8 -4DBS AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYS---
54 HHSearch 92.7288%-111 - C8 -1S1P AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPT