@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00248_AK1C2_: (2014-09-03 )
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Atome Classification :

(69 SA) .........10........20....-....30........40........50........60........-70---........80........90........100.......110.......120...--------..--..130.......140........150..---.....160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.----......270.......280.......290.......-300--....---------...310....-...320.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
3 PsiBlast_PDB 99.3099%-114 - C6 -2IPJ AK1C2_HUMAN A:[1-321] --SKYQCVKLNDGHFMPVLGFGTAA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
2 PsiBlast_PDB 99.23100%-119 - C6 -1J96 AK1C2_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
27 PsiBlast_CBE 99.1099%-115 - C6 -2IPJ AK1C2_HUMAN B:[1-321] --SKYQCVKLNDGHFMPVLGFGTAA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
22 PsiBlast_CBE 98.85100%-115 - C6 -2HDJ AK1C2_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
1 PsiBlast_PDB 98.71100%-117 - C6 -1XJB AK1C2_HUMAN A:[4-325] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
21 PsiBlast_CBE 98.69100%-115 - C6 -2HDJ AK1C2_HUMAN B:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
25 PsiBlast_CBE 98.54100%-114 - C6 -1XJB AK1C2_HUMAN B:[4-325] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
26 PsiBlast_CBE 98.11100%-119 - C6 -1J96 AK1C2_HUMAN B:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIP-----KILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
24 PsiBlast_CBE 97.39100%-111 - C6 -1IHI AK1C2_HUMAN A:[3-322] --SKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDE-
23 PsiBlast_CBE 97.21100%-110 - C6 -1IHI AK1C2_HUMAN B:[3-322] --SKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDE-
29 PsiBlast_CBE 97.2097%-114 - C6 -3C3U AK1C1_HUMAN A:[4-323] ---KYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
5 PsiBlast_PDB 97.1097%-113 - C6 -1MRQ AK1C1_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
28 PsiBlast_CBE 96.5397%-114 - C6 -3NTY AK1C1_HUMAN A:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TLDIFAGPPN-YPFSDEY
4 PsiBlast_PDB 96.2697%-118 - C6 -3GUG AK1C1_HUMAN A:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EE--VIPKDENGKILFD-TVDLCATWEAVEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN--VRYL---------TVDIFAGPPN-YPFSDEY
7 PsiBlast_PDB 94.1086%-113 - C6 -1RY8 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
46 PsiBlast_CBE 94.0886%-115 - C6 -4DBS AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
9 PsiBlast_PDB 93.9786%-112 - C6 -2F38 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
44 PsiBlast_CBE 93.8486%-114 - C6 -4DBW AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
13 PsiBlast_PDB 93.8286%-114 - C6 -4DBU AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYS---
45 PsiBlast_CBE 93.7986%-109 - C6 -4DBU AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
42 PsiBlast_CBE 93.7786%-114 - C6 -1S1R AK1C3_HUMAN A:[6-321] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSD--
47 PsiBlast_CBE 93.7286%-114 - C6 -1RY8 AK1C3_HUMAN B:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
48 PsiBlast_CBE 93.6286%-115 - C6 -1RY0 AK1C3_HUMAN B:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
8 PsiBlast_PDB 93.5086%-116 - C6 -1XF0 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPE---SKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
12 PsiBlast_PDB 93.1886%-114 - C6 -4DBS AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYS---
6 PsiBlast_PDB 93.1086%-114 - C6 -1RY0 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYSDEY
33 PsiBlast_CBE 92.9086%-111 - C6 -4FAM AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-AD---GSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EE--LSPTDENGKVIFD-IVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR----GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN--LHYF---------NSDSFASHPN-YPYS---