@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00303_TYSY_E: (2014-09-04 )
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI

Atome Classification :

(60 SA) .........10........20........30-........40-........50........60........70........80...------------..--------------------------------------------------...90........100.--------------------------...--------...110.......120.......130.......140.......150--..---..---...160.......170.......180.......190.......200.......210.......220.......230.......240--------..---.....250.......260..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
16 PsiBlast_PDB 97.6699%-137 - C7 -2VET TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
13 PsiBlast_PDB 97.49100%-139 - C7 -2KCE TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
22 PsiBlast_CBE 97.24100%-139 - C7 -2BBQ TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
31 PsiBlast_CBE 97.2399%-140 - C7 -2TSC TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRAPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
30 PsiBlast_CBE 97.0799%-135 - C7 -3B5B TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
17 PsiBlast_PDB 97.0399%-135 - C7 -3B5B TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
21 PsiBlast_CBE 97.01100%-137 - C7 -2KCE TYSY_ECOLI B:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
12 PsiBlast_PDB 96.80100%-134 - C7 -2BBQ TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
18 PsiBlast_PDB 96.7899%-138 - C7 -2TSC TYSY_ECOLI A:[1-264] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRAPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
77 HHSearch 86.9367%-132 * C7 *4FQS TYSY_MYCTU A:[1-263] MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSAG-FPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWA------------SD--------------------------------------------------TGELGPIYGVQWRSWPA--------------------------PSG--------EHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQF--YV---AD---GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLAD-RDSIFEY--------TY---EDIVVKNYDPHPAIKAPVAV
74 HHSearch 84.3660%-137 - C7 -4DQ1 TYSY_STAAM A:[9-317] DAAYHSLCEEVLEIGNTRNDRTNTGTISKFG-HQLRFDLSKG-FPLLTTKKVSFKLVATELLWFIKGDTNIQYLLKYNNNIWNEWA------------FENYIKSDEYNGPDMTDFGHRALSDPEFNEQYKEQMKQFKQRILEDDTFAKQFGDLGNVYGKQWRDWVD--------------------------KDG--------NHFDQLKTVIEQIKHNPDSRRHIVSAWNPTEIDTMALPPCHTMFQF--YV---QD---GKLSCQLYQRSADIFLGVPFNIASYALLTHLIAKECGLEVGEFVHTFGDAHIYSNHIDAIQTQLARESFNPPTLKINSD-KSIFDI--------NY---EDLEIVDYESHPAIKA----
78 HHSearch 83.5655%-127 - C7 -4EZ8 TYSY_MOUSE A:[24-307] ELQYLRQVEHILRCGFKKEDRTGTGTLSVFG-MQARYSLRDE-FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVRIWDANGSRDFLDSLGFSARQ--------------------------------------------------EGDLGPVYGFQWRHFGAEYKDMDSD------------------YSG--------QGVDQLQKVIDTIKTNPDDRRIIMCAWNPKDLPLMALPPCHALCQF--YV---VN---GELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLQPGDFVHTLGDAHIYLNHIEPLKIQLQREPRPFPKLKILRKVETIDDF--------KV---EDFQIEGYNPHPTIKMEMAV
93 HHSearch 83.2248%-132 - C7 -3QG2 ? A:[325-608] EYQYLNIIYDIMMNGNKQSDRTGVGVLSKFG-YIMKFDLSQY-FPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHRE--------------------------------------------------VNDLGPIYGFQWRHFGAEYTNMYDN------------------YEN--------KGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQF--YV---FD---GKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDF--------TI---SDFTIQNYVHHEKISMDMAA
84 HHSearch 82.5348%-129 - C7 -1J3K ? C:[45-328] EYQYLNIIYDIMMNGNKQSDRTGVGVLSKFG-YIMKFDLSQY-FPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHRE--------------------------------------------------VNDLGPIYGFQWRHFGAEYTNMYDN------------------YEN--------KGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQF--YV---FD---GKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDF--------TI---SDFTIQNYVHHEKISMDMAA
80 HHSearch 81.8252%-135 - C7 -4G9U ? A:[36-313] ELNYLNQLKDIIDHGVRKNDRTGIGTLSTFG-TQSRYCLRDDIFPLLTTKRVFWRGVVEELLWFISGSTNAKQLSEKNVNIWDGNSSREFLDSRGLYNYE--------------------------------------------------EGDLGPVYGFQWRHFGCPYSSMTAD------------------YKG--------KGYDQLQQCIKMIREEPESRRIIMTAWNPCDLEKVALPPCHCFVQF--YV---AD---GELSCQMYQRSADMGLGVPFNIASYSLLTRMIAHITSLKPGFFIHTIGDAHVYLTHVDALKVQMERKPRPFPKLKILRNVENIDDF--------RA---EDFELINYKPYPK-------
88 HHSearch 81.1448%-130 - C7 -3NRR ? A:[232-515] EFQYLDILADVLSHGVLKPNRTGTDAYSKFG-YQMRFDLSRS-FPLLTTKKVALRSIIEELLWFIKGSTNGNDLLAKNVRIWELNGRRDFLDKNGFTDRE--------------------------------------------------EHDLGPIYGFQWRHFGAEYLDMHAD------------------YTG--------KGIDQLAEIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQF--YV---SD---NKLSCMMHQRSCDLGLGVPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIARIPHPFPRLRLNPDIRNIEDF--------TI---DDIVVEDYVSHPPIPMAMSA
81 HHSearch 80.1749%-123 - C7 -1F28 TYSY_PNECA A:[6-297] EQQYLNLVQYIINHGEDRPDRTGTGTLSVFAPSPLKFSLRNKTFPLLTTKRVFIRGVIEELLWFIRGETDSLKLREKNIHIWDANGSREYLDSIGLTKRQ--------------------------------------------------EGDLGPIYGFQWRHFGAEYIDCKTN------------------YIG--------QGVDQLANIIQKIRTSPYDRRLILSAWNPADLEKMALPPCHMFCQF--YVHIPSNNHRPELSCQLYQRSCDMGLGVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDHIEALQQQLTRSPRPFPTLSLNRSITDIEDF--------TL---DDFNIQNYHPYETIKMKMSI
85 HHSearch 75.6641%-120 - C7 -3V8H ? A:[5-318] MKQYLDLVRTILDTGTWQSN--GIRTIGIPG-AMLRFDLQQG-FPAVTTKKLAFKSAIGELVGFLRATRSAAEFRALGCKVWDANA------------NENAQWLANPYRRG--------------------------------------ADDLGDVYGVQWRRWPGYKVLDAHADAQIADATSRGFRIVARFEEGGADKVLLHKAIDQLRDCLDTIVRDPSSRRILFHGWNPAVLDEIALPACHLLYQFLPNV---ER---REISLCLYIRSNDVGLGTPFNLAEGAALLTLVGRLTGYSPRWFTYFIGDAHIYENQLDMLKQQLEREPFESPRLELAERVPDYAKTGKYEPQWLERVEPSDFTLVGYRHH---------
29 PsiBlast_CBE 66.23100% -27 - C7 -1AN5 TYSY_ECOLI B:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
11 PsiBlast_PDB 66.17100% -27 - C7 -1SYN TYSY_ECOLI A:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
24 PsiBlast_CBE 66.12100% -31 - C7 -1TLC TYSY_ECOLI B:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
8 PsiBlast_PDB 65.94100% -30 - C7 -1BID TYSY_ECOLI A:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
43 PsiBlast_CBE 65.88100% -23 - C7 -3BHL TYSY_ECOLI A:[4-264] -KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
7 PsiBlast_PDB 65.79100% -26 - C7 -1BDU TYSY_ECOLI A:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
59 PsiBlast_CBE 65.77100% -30 - C7 -1JTQ TYSY_ECOLI B:[4-264] -KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
19 PsiBlast_PDB 65.67100% -25 - C7 -1KCE TYSY_ECOLI A:[4-264] -KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
53 PsiBlast_CBE 65.65100% -29 - C7 -1KZI TYSY_ECOLI A:[4-264] -KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
23 PsiBlast_CBE 65.60100% -25 - C7 -1TSD TYSY_ECOLI B:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
15 PsiBlast_PDB 65.59100% -26 - C7 -1AOB TYSY_ECOLI A:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
26 PsiBlast_CBE 65.53100% -28 - C7 -1SYN TYSY_ECOLI B:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI
2 PsiBlast_PDB 65.39100% -27 - C7 -1TSD TYSY_ECOLI A:[4-265] MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQDG-FPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------DE--------------------------------------------------NGDLGPVYGKQWRAWPT--------------------------PDG--------RHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQF--YV---AD---GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDY--------RF---EDFEIEGYDPHPGIKAPVAI