@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF01048_PNPH_H: (2014-09-19 )
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Atome Classification :

(40 SA) .........10........20.-.-......30........40....-....50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250-.......260.......270.......280.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
36 PsiBlast_CBE 97.1299%-125 - C5 -1V41 PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
35 PsiBlast_CBE 97.0999%-127 - C5 -1V45 PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
10 PsiBlast_PDB 96.9699%-121 - C5 -3D1V PNPH_HUMAN A:[2-289] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
1 PsiBlast_PDB 96.9499%-124 - C5 -1PF7 PNPH_HUMAN E:[2-289] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
15 PsiBlast_PDB 96.8899%-134 - C5 -3GB9 PNPH_HUMAN A:[25-307] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLP----
32 PsiBlast_CBE 96.8399%-138 - C5 -3GGS PNPH_HUMAN B:[23-307] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLP----
19 PsiBlast_PDB 96.8099%-127 - C5 -1V2H PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
12 PsiBlast_PDB 96.7499%-128 - C5 -3K8Q PNPH_HUMAN A:[1-286] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD---
31 PsiBlast_CBE 96.7099%-133 - C5 -3GGS PNPH_HUMAN C:[25-307] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRST----AGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLP----
16 PsiBlast_PDB 96.6699%-135 - C5 -3GGS PNPH_HUMAN A:[25-308] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD---
33 PsiBlast_CBE 96.6399%-138 - C5 -3GB9 PNPH_HUMAN C:[23-307] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRST----AGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYES---------VLAAGKQAAQKLEQFVSILMASIPLP----
41 PsiBlast_CBE 96.6199%-131 - C5 -2ON6 PNPH_HUMAN A:[1-286] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRS----HAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANFEEVLAAGKQAAQKLEQFVSILMASIPLPD---
18 PsiBlast_PDB 96.6099%-131 - C5 -1RCT PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
2 PsiBlast_PDB 96.5799%-129 - C5 -1RR6 PNPH_HUMAN A:[3-284] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPL-----
8 PsiBlast_PDB 96.4899%-123 - C5 -3BGS PNPH_HUMAN A:[1-286] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD---
4 PsiBlast_PDB 96.4899%-128 - C5 -1RT9 PNPH_HUMAN A:[3-284] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPL-----
3 PsiBlast_PDB 96.4899%-128 - C5 -1RSZ PNPH_HUMAN A:[3-284] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPL-----
13 PsiBlast_PDB 96.3799%-124 - C5 -3INY PNPH_HUMAN A:[2-289] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
53 PsiBlast_CBE 96.2298%-131 - C5 -4EB8 PNPH_HUMAN C:[39-321] ---GYTYEDYKNTAEYLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANWEEVLAAGKQAAQKLEQFVSILMASIPLPD---
42 PsiBlast_CBE 96.1999%-128 - C5 -2A0X PNPH_HUMAN A:[3-284] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANFEEVLAAGKQAAQKLEQFVSILMASIPL-----
40 PsiBlast_CBE 96.1499%-130 - C5 -2A0Y PNPH_HUMAN A:[3-284] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANDEEVLAAGKQAAQKLEQFVSILMASIPL-----
34 PsiBlast_CBE 96.1199%-138 - C5 -3GB9 PNPH_HUMAN B:[23-307] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYGEIPNFPRST-----GRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFQTVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITDKVIMDYE-------------AGKQAAQKLEQFVSILMASIPLP----
5 PsiBlast_PDB 96.0999%-127 - C5 -1YRY PNPH_HUMAN E:[2-289] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
44 PsiBlast_CBE 96.0799%-128 - C5 -2A0W PNPH_HUMAN A:[3-284] --NGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANGEEVLAAGKQAAQKLEQFVSILMASIPL-----
39 PsiBlast_CBE 96.0199%-129 - C5 -2OC4 PNPH_HUMAN A:[1-286] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANDEEVLAAGKQAAQKLEQFVSILMASIPLPD---
54 PsiBlast_CBE 95.8798%-132 - C5 -4EB8 PNPH_HUMAN B:[36-321] MENGYTYEDYKNTAEYLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANWEEVLAAGKQAAQKLEQFVSILMASIPLPD---
38 PsiBlast_CBE 95.8499%-126 - C5 -1PWY PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
7 PsiBlast_PDB 95.7699%-124 - C5 -1ULB PNPH_HUMAN A:[1-289] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
20 PsiBlast_PDB 95.7499%-125 - C5 -1V3Q PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
43 PsiBlast_CBE 95.7399%-127 - C5 -2OC9 PNPH_HUMAN A:[1-284] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPR------AGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANGEEVLAAGKQAAQKLEQFVSILMASIPL-----
37 PsiBlast_CBE 95.6399%-128 - C5 -1RFG PNPH_HUMAN E:[1-288] -ENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
55 PsiBlast_CBE 95.5798%-128 - C5 -4EB8 PNPH_HUMAN A:[36-321] MENGYTYEDYKNTAEYLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANWEEVLAAGKQAAQKLEQFVSILMASIPLPD---
9 PsiBlast_PDB 95.0499%-123 - C5 -2Q7O PNPH_HUMAN E:[1-284] MENGYTYEDYKNTAEWLLSHTK-H-RPQVAIICGSGLGGLTDKLTQA-QIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESL-EKANHEEVLAAGKQAAQKLEQFVSILMASIPL-----
73 HHSearch 92.7388%-128 * C5 *3FUC PNPH_BOVIN A:[3-283] --NGYTYEDYQDTAKWLLSHTE-Q-RPQVAVICGSGLGGLVNKLTQA-QTFDYSEIPNFP--------GRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQ-GKANHEEVLEAGKQAAQKLEQFVSLLMASIP------
77 HHSearch 83.7355%-118 - C5 -2P4S ? A:[90-371] ----YTYDTLQEIATYLLERTE-L-RPKVGIICGSGLGTLAEQLTDV-DSFDYETIPHFPVSTVAGHVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKYRVGDIMLIKDHINLMGFAGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGIENELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEE-EEHCHDSIVGVGKNREKTLGEFVSRIVKHIHYEA---
76 HHSearch 79.5848%-121 - C5 -1TCV ? A:[5-286] --VTANIENVKKVAHHIQKLTS-I-VPEIGIICGSGLGKLADGVKDK-ITIPYTKIPNFPQTS---HSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESD------------GAQRAELMQSWFEKIIEKLPK-----
83 HHSearch 78.6048%-128 - C5 -4LNA ? A:[23-293] -----MFEQIQETTQFIQSKIT-L-RPAIGIILGTGLGALTNELDID-TTIPYETIPHFPLSTV---SGKLLIGTLGGKSVVVMQGRFHYYEGYTMQQVTYPVRVMHALGIQTLLVSNAAGGMNPTFQTSDLMVIDDHISL--LLPQNPLICPNPPIFGDRFPDMSEPYRKSLIDLAFSVAAELDIP--LKRGVYVSVTGPQLETRAEYRMLRQWGADAVGMSTVPEVIVANQLGMDVFGISVITDLCFPD--TL-EKAELVKILATAAQAEPKLTMLIREMIGRL-------
79 HHSearch 75.2746%-116 - C5 -4NSN ? A:[27-295] ------EQHYHEAASFLSSRLP-G-DAKTAIILGSGLGELAEKIENK-TVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHIN---NLP-NPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQELNIP--VKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHF--ADDFVNDEQDVIRAANAASEKMGAIFARLIAAV-------
80 HHSearch 74.8841%-117 - C5 -3ODG ? A:[14-285] -----FNELPFQAVKYIQKIKPGF-KPQIAFILGSGLGDLVDQITND-TTISYADIPGFPVSSVHGHAGELVLGDLCGVPVMCMKGRGHFYEGKGMSIMTNPVRTFKLMGCEFLFCTNAAGSLRPEVLPGSVVMLKDHIN---TMPGTPLVGPNDDRFGPRFFSLANAYDKDLRADMAKIAQQLDIP--LTEGVFVSYPGPCFETPAEIRMMQIIGGDVVGMSVVPEVLSAAHCGLKVIALTAITNLAEGL--SD-VVLSHEQTLKFAKVASVNFTKLIEAFLKSKA------
78 HHSearch 69.9138%-119 - C5 -1G2O PUNA_MYCTU A:[8-268] -----PDELARRAAQVIADRTG-IGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNL---TARSPLV-------GGEFVDLTDAYSPRLRELARQSDP------QLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGI--TG-EPLSHAEVLAAGAASATRMGALLADVIARF-------