@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF01471_MMP12_: (2014-09-24 )
MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKITTGKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGPGIGGDTHFDEDEIWSKSYKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPEPTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIHSLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC

Atome Classification :

(54 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140......-.-------150.......160.......170.......180..---.....190.......200---........210.......220.......230.......240.......250.......260.......270.-......280.......290.......300.......310.......320.......330.......340.......350.......360..-.....370.......380.......390.......400.......410.......420.......430.......440.......450.......460..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKFLLLILTLWVTSSGADPLKENDMLFAENYLENFYGLKVERIPMTKMKTNRNFIEEKVQEMQQFLGLNVTGQLDTSTLEMMHKPRCGVPDVYHFKTMPGRPVWRKHYITYRIKNYTPDMKREDVEYAIQKAFQVWSDVTPLKFRKIT-T-------GKADIMILFASGAHGDYGAFDGRGGVIAHAFGPGP---GIGGDTHFDEDEIWSK-S---YKGTNLFLVAVHELGHALGLDHSNDPKAIMFPTYGYIDLNTFHLSADDIRGIQSLYGGPEQHQPMPKPDNPE-PTACDHNLKFDAVTTVGNKIFFFKDSFFWWKIPKSSTTSVRLISSLWPTLPSGIEAAYEIGDRHQVFLFKGDKFWLISHLRLQPNYPKSIH-SLGFPDFVKKIDAAVFNPSLRKTYFFVDNLYWRYDERREVMDAGYPKLITKHFPGIGPKIDAVFYFQRYYYFFQGPNQLEYDTFSSRVTKKLKSNSWFDC
8 PsiBlast_PDB 82.3448%-113 - C2 -4G0D MMP13_HUMAN A:[1-368] ----------------------------------------------------------------------------------------------YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLH-D-------GIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGP---NYGGDAHFDDDETWTS-S---SKGYNLFLVAAHAFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDED---PNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKIS-ELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
3 PsiBlast_PDB 82.0851%-113 - C2 -1FBL MMP1_PIG A:[1-367] ----------------------------------------------------------------------------------------------FVLTPGNPRWENTHLTYRIENYTPDLSREDVDRAIEKAFQLWSNVSPLTFTKVS-E-------GQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGP---GIGGDAHFDEDERWTK-N---FRDYNLYRVAAHELGHSLGLSHSTDIGALMYPNYIYT--GDVQLSQDDIDGIQAIYGPSE--NPV-QPSGPQTPQVCDSKLTFDAITTLRGELMFFKDRFYMRTNSFYPEVELNFISVFWPQVPNGLQAAYEIADRDEVRFFKGNKYWAVRGQDVLYGYPKDIHRSFGFPSTVKNIDAAVFEEDTGKTYFFVAHECWRYDEYKQSMDTGYPKMIAEEFPGIGNKVDAVFQKDGFLYFFHGTRQYQFDFKTKRILTLQKANSWFNC
7 PsiBlast_PDB 81.1148%-114 - C2 -4FVL ? A:[1-368] ----------------------------------------------------------------------------------------------YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLH-D-------GIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGP---NYGGDAHFDDDETWTS-S---SKGYNLFLVAAHAFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDED---PNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKIS-ELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
9 PsiBlast_PDB 51.6876%-107 - C2 -1JIZ MMP12_HUMAN A:[2-165] ----------------------------------------------------------------------------------------------FREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 51.4276%-108 - C2 -1JIZ MMP12_HUMAN B:[2-165] ----------------------------------------------------------------------------------------------FREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 51.1375%-110 - C2 -2WO8 MMP12_HUMAN C:[3-163] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
56 PsiBlast_CBE 51.0777%-111 - C2 -4GR3 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
43 PsiBlast_CBE 50.9475%-111 - C2 -3UVC MMP12_HUMAN B:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 50.8375%-107 - C2 -2WOA MMP12_HUMAN C:[3-163] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
60 PsiBlast_CBE 50.7977%-111 - C2 -3TS4 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
77 PsiBlast_CBE 50.7877%-108 - C2 -3LKA MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
61 PsiBlast_CBE 50.7877%-110 - C2 -3LJG MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 PsiBlast_PDB 50.7877%-111 - C2 -1RMZ MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 50.7077%-111 - C2 -1UTZ MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 50.6875%-106 - C2 -2WOA MMP12_HUMAN A:[3-163] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
47 PsiBlast_CBE 50.6077%-110 - C2 -4H84 MMP12_HUMAN B:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
63 PsiBlast_CBE 50.5477%-108 - C2 -3LIL MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 50.5175%-106 - C2 -2WO9 MMP12_HUMAN C:[3-164] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKEN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
30 PsiBlast_CBE 50.4975%-107 - C2 -2WO8 MMP12_HUMAN B:[3-163] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
68 PsiBlast_CBE 50.4677%-109 - C2 -2HU6 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 50.4275%-107 - C2 -2WOA MMP12_HUMAN B:[3-163] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 50.3775%-105 - C2 -2WO9 MMP12_HUMAN A:[3-163] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
42 PsiBlast_CBE 50.3577%-107 - C2 -1UTZ MMP12_HUMAN B:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
49 PsiBlast_CBE 50.3477%-110 - C2 -4H76 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
71 PsiBlast_CBE 50.2977%-108 - C2 -4GUY MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
65 PsiBlast_CBE 50.2477%-108 - C2 -2OXZ MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 50.1977%-112 - C2 -4GR0 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
52 PsiBlast_CBE 50.1777%-108 - C2 -4H49 MMP12_HUMAN B:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
48 PsiBlast_CBE 50.1677%-108 - C2 -4H84 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
74 PsiBlast_CBE 50.1077%-106 - C2 -3NX7 MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
53 PsiBlast_CBE 50.1077%-106 - C2 -4H49 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
31 PsiBlast_CBE 50.0575%-110 - C2 -1ROS MMP12_HUMAN B:[2-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGD---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
76 PsiBlast_CBE 50.0477%-105 - C2 -3N2U MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
72 PsiBlast_CBE 49.9977%-104 - C2 -3RTT MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 49.9977%-107 - C2 -1UTT MMP12_HUMAN A:[2-158] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 49.9777%-106 - C2 -4H30 MMP12_HUMAN A:[3-159] -----------------------------------------------------------------------------------------------------PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN-T-------GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGS---GIGGDAHFDEDEFWTT-H---SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------