@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00105_ESR1_MOUSE: (2016-03-18 )
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI

Atome Classification :

(180 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400...----....410.......420.......430.......-440.......450.......460.......470.......480.......490.......500.......510.......520.......530.......540.......550.......560.......570.......580.......590.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI
50 PsiBlast_CBE 93.0996%-138 - C4 -2YJA B:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRL----------------------------------------------
35 PsiBlast_CBE 92.5595%-142 - C4 -2P15 B:[10-254] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLH---------------------------------------------
125 PsiBlast_CBE 92.4796%-144 - C4 -1GWR B:[1-244] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDP--PFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHR-----------------------------------------------
64 PsiBlast_CBE 92.4796%-136 - C4 -1QKU ESR1_HUMAN A:[1-250] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLH---------------------------------------------
107 PsiBlast_CBE 92.4696%-142 - C4 -4IWC B:[3-247] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFL--TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCK---PLSDLLLEMLDAHRL----------------------------------------------
179 PsiBlast_CBE 92.3494%-145 - C4 -4MGC B:[8-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
137 PsiBlast_CBE 92.2795%-139 - C4 -2AYR A:[3-248] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLESAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKSVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKSKNVVPLYDLLLEMLDAHRLHA--------------------------------------------
30 PsiBlast_CBE 92.2495%-140 - C4 -2QGW B:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYT---STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
15 PsiBlast_PDB 92.2495%-142 - C4 -2QSE ESR1_HUMAN A:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSE----RPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRN---CVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
63 PsiBlast_CBE 92.1796%-141 - C4 -1QKU ESR1_HUMAN B:[4-250] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLH---------------------------------------------
27 PsiBlast_CBE 92.1195%-144 - C4 -2QSE B:[10-254] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLH---------------------------------------------
103 PsiBlast_CBE 92.0794%-144 - C4 -3Q97 B:[10-254] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
141 PsiBlast_CBE 92.0296%-139 - C4 -1X7E ESR1_HUMAN A:[1-245] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPVK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFL-------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRL----------------------------------------------
150 PsiBlast_CBE 91.9895%-138 - C4 -4MG5 ESR1_HUMAN A:[8-250] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAH------------------------------------------------
70 PsiBlast_CBE 91.9896%-146 - C4 -1YIM A:[1-245] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA--------------------------------------------
93 PsiBlast_CBE 91.9795%-144 - C4 -4MG9 ESR1_HUMAN A:[8-251] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
91 PsiBlast_CBE 91.9095%-140 - C4 -4MGD ESR1_HUMAN A:[8-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGK--EGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
145 PsiBlast_CBE 91.8895%-142 - C4 -4MGA ESR1_HUMAN A:[8-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKC--GMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
162 PsiBlast_CBE 91.8194%-141 - C4 -3Q97 ESR1_HUMAN A:[7-255] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
111 PsiBlast_CBE 91.7496%-143 - C4 -4IW6 B:[3-246] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQ---VEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF------SLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
32 PsiBlast_CBE 91.7195%-141 - C4 -2QAB B:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
7 PsiBlast_PDB 91.7195%-136 - C4 -2P15 ESR1_HUMAN A:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEY---RPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
66 PsiBlast_CBE 91.6994%-142 - C4 -3Q95 ESR1_HUMAN A:[11-256] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLS--LKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLH---------------------------------------------
62 PsiBlast_CBE 91.6796%-140 - C4 -1QKU C:[4-250] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLH---------------------------------------------
176 PsiBlast_CBE 91.6495%-140 - C4 -1PCG B:[1-244] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLESAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKSVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLS-TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKSKNVVPLYDLLLEMLDAH------------------------------------------------
81 PsiBlast_CBE 91.6296%-136 - C4 -1GWQ B:[1-248] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SKKNSLALSLTADQMVSALLDAEPPILYSE------FSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHR-----------------------------------------------
60 PsiBlast_CBE 91.6295%-140 - C4 -3HLV B:[7-251] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLS-----LEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
28 PsiBlast_CBE 91.6295%-143 - C4 -2QR9 B:[10-254] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLH---------------------------------------------
9 PsiBlast_PDB 91.6095%-140 - C4 -2QA6 ESR1_HUMAN A:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYD--RPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
94 PsiBlast_CBE 91.5995%-141 - C4 -4MG7 ESR1_HUMAN A:[8-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQ----EGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
43 PsiBlast_CBE 91.5296%-144 - C4 -2OUZ A:[6-251] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA--------------------------------------------
102 PsiBlast_CBE 91.5196%-141 - C4 -3UUA ESR1_HUMAN A:[4-247] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
89 PsiBlast_CBE 91.5096%-140 - C4 -1G50 ESR1_HUMAN A:[1-247] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLH---------------------------------------------
26 PsiBlast_CBE 91.4995%-143 - C4 -2QXM B:[10-254] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLH---------------------------------------------
14 PsiBlast_PDB 91.4695%-138 - C4 -2QR9 ESR1_HUMAN A:[9-253] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEY---RPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
12 PsiBlast_PDB 91.4595%-145 - C4 -2QGW ESR1_HUMAN A:[9-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
10 PsiBlast_PDB 91.4495%-145 - C4 -2QAB ESR1_HUMAN A:[9-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
72 PsiBlast_CBE 91.3996%-144 - C4 -1XP9 A:[1-245] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA--------------------------------------------
82 PsiBlast_CBE 91.3896%-136 - C4 -1GWQ ESR1_HUMAN A:[1-248] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SKKNSLALSLTADQMVSALLDAEPPILYSE-----PFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHR-----------------------------------------------
74 PsiBlast_CBE 91.3896%-143 - C4 -1XP1 A:[1-245] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA--------------------------------------------
11 PsiBlast_PDB 91.3795%-146 - C4 -2QGT ESR1_HUMAN A:[9-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFL-------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
161 PsiBlast_CBE 91.3595%-145 - C4 -3UUD ESR1_HUMAN A:[4-248] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
88 PsiBlast_CBE 91.3696%-141 - C4 -1G50 ESR1_HUMAN B:[1-246] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRL----------------------------------------------
108 PsiBlast_CBE 91.3596%-142 - C4 -4IWC ESR1_HUMAN A:[3-246] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
140 PsiBlast_CBE 91.3396%-141 - C4 -1X7E B:[1-245] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPVK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFL-------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRL----------------------------------------------
126 PsiBlast_CBE 91.3196%-141 - C4 -1GWR ESR1_HUMAN A:[2-245] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LALSLTADQMVSALLDAEPPILYSEY---RPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF---TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRL----------------------------------------------
158 PsiBlast_CBE 91.2896%-148 - C4 -4PP6 ESR1_HUMAN A:[1-244] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF----------KDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
163 PsiBlast_CBE 91.2594%-142 - C4 -2G5O B:[7-253] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFL--------EKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLH---------------------------------------------
146 PsiBlast_CBE 91.2595%-145 - C4 -4MG8 ESR1_HUMAN A:[8-251] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
73 PsiBlast_CBE 91.2696%-144 - C4 -1XP6 A:[1-245] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA--------------------------------------------
119 PsiBlast_CBE 91.2496%-139 - C4 -4IV2 B:[3-246] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRN--KCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVY----STLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
115 PsiBlast_CBE 91.2496%-142 - C4 -4IVW B:[2-246] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQG--VEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF-----KSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
106 PsiBlast_CBE 91.2396%-141 - C4 -4IWF ESR1_HUMAN A:[3-246] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR-----------------------------------------------
170 PsiBlast_CBE 91.2094%-143 - C4 -1ZKY B:[8-252] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL----------------------------------------------
153 PsiBlast_CBE 91.1996%-144 - C4 -4PPS B:[1-244] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGK----LLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRF-RMMNLQGEEFVCLKSIILLNSGVYTF--------EEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQL