@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Ampho_RBD: (2013-07-30 )
MARSTLSKPPQDKINPWKPLIVMGVLLGVGMAESPHQVFNVTWRVTNLMTGRTANATSLLGTVQDAFPKLYFDLCDLVGEEWDPSDQEPYVGYGCKYPAGRQRTRTFDFYVCPGHTVKSGCGGPGEGYCGKWGCETTGQAYWKPTSSWDLISLKRGNTPWDTGCSKVACGPCYDLSKVSNSFQGATRGGRCNPLVLEFTDAGKKANWDGPKSWGLRLYRTGTDPITMFSLTRQVLNVGPRVPIG

Atome Classification :

(20 SA) .......------..10....-----------...-.20......-..30.....--------------...40........50--.....-....60.--....----.-.-.70........---.80--........---------------------------.--90----------------------------...------------------.----.....100.------..-----------------.-----------.------------..110-----------..-.---...---.120-----....-----....-.-130-........140.......150--------.......160......-.170.......180---------......---..----------190.....----..200...-....210........220.......230.--......240...-----------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MARSTLS------KPPQDKIN-----------PWK-PLIVMGVLL-GVGMAESPH--------------QVFNVTWRVTNLMT---GRTAN-ATSLLGT--VQDA----F-P-KL-YFDLCDLV---GE---EWDPSDQE---------------------------P--Y-----------------------------VGY------------------G----CKYPAGRQR------TR-----------------T-----------F------------DFYVC-----------PG-H---TVK---SG-------CGGP-----GEGY-C-GK--WGCETTGQAYWKPTSSWDLIS--------LKRGNTPWDTGCSKVA-CGPCYDLSKVSNS----------FQGATR---GG----------RCNPLVLE----FTDAGKKA-NWDGPK-SWGLRLYRTGTDPITMFSLTRQ--VLNVGPRV-PIG-----------
1 PsiBlast_PDB 99.1660% -91 - C6 -1LCS ENV_FLVLB A:[4-208] -----------------------------------------------------PH--------------QVYNVTWTITNLVT---GTKAN-ATSMLGT--LTDA----F-P-TM-YFDLCDII---GN---TWNPSDQE---------------------------P--F-----------------------------PGY------------------G----CDQPMRRWQ------QR-----------------N-----------T------------PFYVC-----------PG-H---ANR---KQ-------CGGP-----QDGF-C-AV--WGCETTGETYWRPTSSWDYIT--------VKKGVTQGIYQCSGGGWCGPCYDKA-VHSS----------TTGASE---GG----------RCNPLILQ----FTQKGRQT-SWDGPK-SWGLRLYRSGYDPIALFSVSRQ--VMTITP-----------------
29 HHSearch 96.6256% -84 * C6 *1LCS ENV_FLVLB A:[4-208] -----------------------------------------------------PH--------------QVYNVTWTITNLVT---GTKAN-ATSMLGT--LTDA----F-P-TM-YFDLCDII---GN---TWNPSDQE---------------------------P--F-----------------------------PGY------------------G----CDQPMRRWQ------QR-----------------N-----------T------------PFYVC-----------PG-H---ANR---KQ-------CGGP-----QDGF-C-AV--WGCETTGETYWRPTSSWDYIT--------VKKGVTQGIYQCSGGG-WCGPCYDKAVHSS----------TTGASE---GG----------RCNPLILQ----FTQKGRQT-SWDGPK-SWGLRLYRSGYDPIALFSVSRQ--VMTITP-----------------
19 Fugue 94.8242% -73 - C6 -1AOL ENV_MLVF5 A:[1-227] ---------------------------------------------------------------------QVYNITWEVTN-GD---RETVW-AISGNHP--LWTW----W-P-VL-TPDLCMLALSGPP---HWGLEYQA---------------------------P--YSSPPGPPCCSGSSGSSAGCSRDCDEPLTSLTP------------------R----CNTAWNRLKLDQVTHKS-----------------S-----------E------------GFYVC-----------PG-SHRPREA---KS-------CGGP-----DSFY-C-AS--WGCETTGRVYWKPSSSWDYIT--------VDNNLT--------------------TSQA----------VQVCKD---NK----------WCNPLAIQ----FTNAGKQVTSWTTGH-YWGLRLYVSGRDPGLTFGIRLR--YQNLGPRV---------------
2 PsiBlast_PDB 89.5133% -77 - C6 -1AOL ENV_MLVF5 A:[1-228] ---------------------------------------------------------------------QVYNITWEVTN-GD---RETVW-AISGNHP--LWTW----W-P-VL-TPDLCMLA---LSGPPHWGLEYQA---------------------------P--Y-----------------------------SSPPGPPCCSGSSGSSAGCSRD----CDEPLTSLT------PRCNTAWNRLKLDQVTHKSS-----------E------------GFYVC-----------PGSH---RPR---EAKS-----CGGP-----DSFY-C-AS--WGCETTGRVYWKPSSSWDYIT--------VDNNLT--------------------TSQA----------VQVCKD---NK----------WCNPLAIQ----FTNAGKQVTSWTTGH-YWGLRLYVSGRDPGLTFGIRLR--YQNLGPRV-P-------------
30 HHSearch 89.2243% -71 - C6 -1AOL ENV_MLVF5 A:[1-228] ---------------------------------------------------------------------QVYNITWEVTN------GDRET-VWAISGNHPLWTW----W-P-VL-TPDLCMLALSGPP---HWGLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPLTS-----------------------------LTP------------------R----CNTAWNRLK------LD-----------------Q-----------VTHKSSE------GFYVC-----------PG-S---HRPREAKS-------CGGP-----DSFY-C-AS--WGCETTGRVYWKPSSSWDYIT--------VDNNLTTSQAV-------QVCKD--------------------------NK----------WCNPLAIQ----FTNAGKQVTSWTTGH-YWGLRLYVSGRDPGLTFGIRLR--YQNLGPRV-P-------------
5 PsiBlast_PDB 50.4425% -34 - C6 -1W3G ? A:[183-306] --------------------------------------------------SQTQE--------------MSFNLSQTLTQTSTF--AYTAG-FTIAVGT--AFKAGVPIF-A-ET-EFKVDISV---DN---QWN-------------------------------------------------------------------W------------------G----EENTFSKTY------TA-----------------T-----------F------------SVRAG-----------PG-E---TVK---AVSTVDSGIINVP-----FTAY-L-SSKSTGFEVTTEGIWRGVSSWDL--------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 50.0025% -24 - C6 -1W3F ? A:[183-306] --------------------------------------------------SQTQE--------------MSFNLSQTLTQTSTF--AYTAG-FTIAVGT--AFKAGVPIF-A-ET-EFKVDISV---DN---QWN-------------------------------------------------------------------W------------------G----EENTFSKTY------TA-----------------T-----------F------------SVRAG-----------PG-E---TVK---AVSTVDSGIINVP-----FTAY-L-SSKSTGFEVTTEGIWRGVSSWDL--------------------------------------------------------------------------------------------------------------------------------------------------
22 Fugue 49.4015% -31 - C7 -1LZJ BGAT_HUMAN A:[1-283] MVSLPRM------VYPQPKVLTPCRKDVLVVTPWL-APIVWEGTF-NIDILNEQF--------------RLQNTTIGLTVFAI---KKYVAFLKLFLET--AEKH----FMV-GH-RVHYYVFT---DQ---PAAVPRVT---------------------------L--G-----------------------------TGR------------------Q----LSVLEVG-------------------------------------------------------------------------------------------ERR-----FLSE-V-DY--LVCVDVDMEFRDHVGVEILTP--------LFGTLHPSFYGSSREA-FT--YERRPQSQAYIPKDEGDFYYMGAFF---GGSVQEVQRLTRACHQAMMV----DQANGIEA-VWHDES-HLNKYLLRHKPTKVLSPEYLWD--QQLLGWPA-VLRKLRFTAVP---
32 HHSearch 49.2438% -51 * C9 *2RFW - ? A:[190-262] --------------------------------------------------------------------------------------------------------------------------------E---GWKSSTSD---------------------------P--N-----------------------------AGV------------------GPYGSCCAEIDVWE------SN-----------------A-----------YAFAFTPHACTTNEYHVC-----------ET-----------TN-------CGGTYSEDRFAGK-C-DA--NGCD-----------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 48.9528% -50 - C8 -1PG2 - SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 48.4925% -26 - C6 -1W3A ? A:[183-306] --------------------------------------------------SQTQE--------------MSFNLSQTLTQTSTF--AYTAG-FTIAVGT--AFKAGVPIF-A-ET-EFKVDISV---DN---QWN-------------------------------------------------------------------W------------------G----EENTFSKTY------TA-----------------T-----------F------------SVRAG-----------PG-E---TVK---AVSTVDSGIINVP-----FTAY-L-SSKSTGFEVTTEGIWRGVSSWDL--------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 47.4928% -45 - C8 -1PG0 - SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
23 Fugue 46.1722% -4 - C4 -3UP6 - ? A:[35-358] -TRAQLSIDLVNNVEQQEKIN-----------S--MRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQS-LTSQLDG--IANL----L-TLQEMIYDISSIL---NS---DGQIISAT---------------------------GM-PM----------------------------TGV------------------I----RDISIAPDE------TK-----------------TVQMVIERAVARV------------DVFIEAIDGGAVTGYTAG-S---TSV---TL-------HNFS-----HDSYFVMGN--VGNGTRDNA--DSSKNYGKVKEDVSESNLLTHSWTAATTETWAYS-SAPGAENRKLLCS----------FYTAERLFKSD----------YSDRLSISMANVLKGPSDVT-GITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW
11 PsiBlast_PDB 42.1928% -52 - C8 -1PFV SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 42.1228% -43 - C8 -1PFU SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 42.0528% -52 - C8 -1PFY - SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 41.9228% -47 - C8 -1P7P SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 41.4628% -45 - C8 -1QQT - SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 41.2928% -50 - C8 -1PFW SYM_ECOLI A:[227-289] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------YMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 41.0228% -43 - C8 -3H9B SYM_ECOLI A:[240-302] --------------------------------------------------------------------------------------------------------------------------------Q---QWDISRDA---------------------------P--Y-----------------------------FGF------------------E----IPNAPGKY----------------------------------------------------FYVW-----------LD-A---PI-----G-------LMGS-----FKNL-C-DK--RGDSVSFDEYWKKDSTAEL--------------------------------------------------------------------------------------------------------------------------------------------------