@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : FeLVC_RBD: (2013-07-30 )
MESPTHPKPSKDKTFPWNLVFLVGILFQIDMGMANPSPHQVYNVTWVITNVQTNSRANATSMLGTLTDAYPTLYVDLCDLVGDTWEPIAPDPRSWARYSSSTHGCKTTDRKKQQQTYPFYVCPGHAPSMGPKGTYCGGAQDGFCAAWGCETTGEAWWKPTSSWDYITVKRGSNQDNSCKGKCNPLVLQFTQKGRQASWDRPKMWGLRLYRSGYDPIALFSVSRQVMTITPPQ

Atome Classification :

(20 SA) -------------------------------------------.........-10......---------------..20..-----......30....----...------------.40.-----....---...-----50........60.---...--...----------------.70...------.....-80---.------..-....-------------.90.---...-------------------------....-------------------------------.100....------..-------------.-110.....------..120-------....-...------..130.-...---...140.........150.--------......160-------------------.......170--....------------------------.------------.---.--------------.----180----........190....-...200.---......210........220....-...230----------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------------------MESPTHPKP-SKDKTFPW---------------NLVFLV-----GILFQIDMGMAN----PSP------------HQVY-----NVTW---VIT-----NVQTNSRANATSM---LGT--LTD----------------AYPTLY------VDLCD-LV---G------DT-WEPI-------------AP-D---PRS-------------------------WARY-------------------------------SSSTHGCK------TT-------------D-RKKQQQTY------PFY---------VCPG-HAP------SMGPKG-TYC---GGAQ--DGFCAAWGCETTG--------EAWWKPTSS-------------------WDYITVKRG---SNQD------------------------N------------S---C--------------K----GK-----CNPLVLQFTQKGRQA-SWDRPKM---WGLRLYRS-GYDPIALFSVSRQVM-TITPPQ----------------------------
18 HHSearch 97.7373% -87 - C8 -1LCS ENV_FLVLB A:[4-208] ---------------------------------------------------------------------------------------------------------P------------HQVY-----NVTW---TIT-----NLVTGTKANATSM---LGT--LTD----------------AFPTMY------FDLCD-II---G------NT-WNPS-------------DQ-E---P---------------------------------------------------------------FPGYGCD------QP-------------M-RRWQQRNT------PFY---------VCPG-HAN---------R---KQC---GGPQ--DGFCAVWGCETTG--------ETYWRPTSS-------------------WDYITVKKG---VTQG------------------------IYQCSGGGWCG--P---CYDKAVHSSTTGASEG----GR-----CNPLILQFTQKGRQT-SWDGPKS---WGLRLYRS-GYDPIALFSVSRQVM-TITP------------------------------
1 PsiBlast_PDB 94.4760% -93 - C8 -1LCS ENV_FLVLB A:[4-208] ---------------------------------------------------------------------------------------------------------P------------HQVY-----NVTW---TIT-----NLVTGTKANATSM---LGT--LTD----------------AFPTMY------FDLCD-II---G------NT-WNPS-------------DQ-E---P---------------------------------------------------------------FPGYGCD------QP-------------M-RRWQQRNT------PFY---------VCPG-HA-----------NR-KQC---GGPQ--DGFCAVWGCETTG--------ETYWRPTSS-------------------WDYITVKKG---VTQGIYQCSGGGWCGPCYDKAVHSSTTGA------------S---E--------------G----GR-----CNPLILQFTQKGRQT-SWDGPKS---WGLRLYRS-GYDPIALFSVSRQVM-TITP------------------------------
2 PsiBlast_PDB 85.5534% -81 - C8 -1AOL ENV_MLVF5 A:[1-225] -----------------------------------------------------------------------------------------------------------------------QVY-----NITW---EVT-----N---GDRETVWAI---SGNHPLWT----------------WWPVLT------PDLCM-LA----------------L-------------SG-P---PHW-------------------------GLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPLTSLTPRCN------TAWNRLKL-------D-QVTHKSSE------GFY---------VCPGSHRP------R---EA-KSC---GGPD--SFYCASWGCETTG--------RVYWKPSSS-------------------WDYITVDNNLTTSQAV------------------------Q------------V---C--------------K----DNKW---CNPLAIQFTNAGKQVTSWTTGHY---WGLRLYVS-GRDPGLTFGIRLRYQ-NLGP------------------------------
19 HHSearch 85.4643% -78 - C8 -1AOL ENV_MLVF5 A:[1-227] -----------------------------------------------------------------------------------------------------------------------QVY-----NITW---EVT-----N---GDRETVWAI---SGNHPLWT----------------WWPVLT------PDLCM-LALSGP------PH-WGLEYQAPYSSPPGPPCCS-G---SSGSSAGCSRDC----------------DEPL-------------------------------TSLTPRCN------TA-------------W-NRLKLDQVTHKSSEGFY---------VCPG-SHR---------PREAKSC---GGPD--SFYCASWGCETTG--------RVYWKPSSS-------------------WDYITVDNN---LTTS------------------------Q------------AVQVC--------------KDN--KW-----CNPLAIQFTNAGKQVTSWTTGHY---WGLRLYVS-GRDPGLTFGIRLRYQ-NLGPRV----------------------------
9 Fugue 84.8838% -69 - C8 -1AOL ENV_MLVF5 A:[1-227] -----------------------------------------------------------------------------------------------------------------------QVY-----NITW---EVT-----N-GDRETVWAISG---NHP--LWT----------------WWPVLT------PDLCM-LA---L------SG-PPHW-------------GL-E---YQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPL-------------------------------TSLTPRCNTAWNRLKL-------------D-QVTHKSSE------GFY---------VCPG-SHR------P--REA-KSC---GGPD--SFYCASWGCETTG--------RVYWKPSSS-------------------WDYITVDNN---LTTS------------------------Q------------A---V--------------Q----VCKDNKWCNPLAIQFTNAGKQVTSWTTGHY---WGLRLYVS-GRDPGLTFGIRLRYQ-NLGPRV----------------------------
11 Fugue 48.1511% -49 - C7 -4KFU ? A:[2-206] ----------------------------------------------------------NPD---------------DIVVLVGRKKSGKSYLIKHYFIP----VLK------------AH-------KISY---IID-----DHNLLRSGSEYSK---FGY--NAT----------------SLSDIV------SKQ-------------------YVV-------------VY-D---RAK-------------------------NDDF-------------------------------FEKLWQAS------KL-------------H-SKKY---G------TTV---------LIID-EAY------YHFKYK-QKV---TPAI--DEALHAN------------------RHAGL-------------------GLILSTQRV---YDLM------------------------P------------I---V--------------Y----KQ-----ADLIIMFYTREPNEL-RWISKYISAEAAEKVKTL-KQYHFLIYDVNSQTI-KIHKPILE--------------------------
12 Fugue 46.4220% -56 * C6 *2Y38 LAMA5_MOUSE A:[8-398] -------------------------GFSLHPPYFNLAEGARITASATCHPVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDL-----GQVFHVAYVLIKFANSPRPDLWVLERSTDFGHTYQ-----PWQF---FAS-----SKRDCLERFGPRT---LER--ITQDDDVICTTEYSRIVPLENGEIV------VSLVNGRP---G------AL-NFSY-------------SP-L---LRD-------------------------FTKA-------------------------------TNIRLRFL------RTNTLLGHLMGKALRD-PTVTRRYY------YSIKDISIGGRCVCHG-HADVCDAKDPLDPFR-LQCACQHNTC--GGSCD-RCCPGFN--------QQPWKPATTDSANECQSCNCHGHAYDCYYDPEVDRRE---ASQN------------------------Q------------D---N--------------VYQGGGV-----CLDC--QHHTTGINC-ERCLPGF--------FRA-PDQPLD----SPHVC-RPAAAH----------------------------
13 Fugue 41.4212% -30 - C7 -3S40 - ? A:[3-300] KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKY-CQEFASKV---------------DLIIVF-----GGDGTVFECTNG----LAP------------LEIR-----PTLA---IIP-----GGTCNDFSRTLGV---PQN--IAE----------------AAKLITKEHVKPVDVAK-AN---G------QH-FLNF-------------WGIG---KIG-------------------------YYLS-------------------------------TIETFPVK------ITY------------D-GQVYEDEA------VLVM--------VG---NGE------YLGGIP-SFI---PNVKCDDGTLDIFVVKSTG--------IQAFKDYIG----------------------KKLFED---SNEN------------------------D------------I---F--------------H----VK-----AKSIHIETEEEK---------------EVDTDSS-LHTPCQIELLQGHFTMIYNPAVV---------------------------
15 Fugue 40.8718% -60 * C4 *3CWX - ? A:[47-176] ----------------------------------------------EVNPDI-IKDEVFDF-----------------VIVN-----RVLKKIK-DLKH----YDPM-----------IEKIFEMGLNVEI---QINPEVKDFFTFKSISTTNKQ---RCF--LSL----------------RGETRE------I-LCD-NK---L------YNMLLAVFN-----------SY-D---PND-------------------------LLKH-------------------------------ISTVESLK------KI-------------F-YTITCEAV------Y----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 Fugue 37.7314% -37 * C5 *3ZZO ? A:[1-93] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ECCTSRE-------------------------LVEF-------------------------------KMDRGDCE------AV-------------RAIENYPNGC------EVT---------ICA----D------GVAQLG-AYC---GQGP-----CNIFGCNCDGGCLSGDWSQEFVRRNQQ-------------------YGIQIIKVT---RLPF------------------------W------------R-------------------------------------------------------------------------------------------------------------------
16 Fugue 33.098% -16 - C7 -3LY7 - CADC_ECOLI A:[190-511] --SRILLNPRDIDINMVNKSCNSWSSPYQLSYAIGVGDLVATSLNTFSTFMV-HDKINYNI---------------DEPSSS-----GKTLSIAFVNQR----QYR------------AQQC-----FMSI---KLV-----DNADGSTMLDKRYVITNGN--QLA----------------IQNDLL------ESLSK-AL---NQPWPQRMQ-ETLQ-------------KI-L---PHR-------------------------GALL-------------------------------TNFYQAHD------YL-------------L-HGDDKSLN------RAS---------ELLG-EIV------QSSPEF-TYA---RAEK--ALVDIVRHSQHPL--------DEKQLAALN-------------------TEIDNIVTL---PELN------------------------NLSIIYQIKAVSAL---V--------------K----GK-----TDESYQAINTGIDLE-MSWLNYV---LLGKVYEM-KGMNREAADAYLTAF-NLRPGANTLYWIENGIFQTSVPYVVPYLDKFLAS
7 PsiBlast_PDB 29.0334% -8 - C3 -2HZ7 - SYQ_DEIRA A:[301-354] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RRG---LEYT------------------------I------------T---S--------------K----RK-----LRELV----QAGRVS-GWDDPRM---PTLRAQRRLGVTPEAVRAFAAQI------------------------------------
25 HHSearch 27.6319% -19 - C8 -2GUM - GB_HHV1K A:[51-108] --------------------------------------------------------------------------------------------------N----IAP------------Y-KF-----KATMYYKDVT-----VSQVWFGHRYSQF---MGI--FED----------------RAPVPFEEV---IDKIN-AK---G------VC-RST--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 Fugue 27.1219% -12 - C6 -1L3Y - A:[1-41] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ECDT-INC------E-RYNG-QVC---GGPG--RGLCFCGKCRCHP--------GFEGSACQA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 24.6231% 48 - C9 -3UGT - SYTM_YEAST A:[104-141] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------WENY-------------------------------ADDMFKVE------TT-----------------KEEYGL------KPM---------NCPG-HCL------IFGKK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 Fugue 24.0025% 47 - C7 -2OKR - F:[1-24] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IKI------------------------K------------K---I--------------E----DA-----SNPLLLKRRKKARAL----------------------------------------------------------------------
24 HHSearch 23.8719% 32 * C7 *4DF0 - ? A:[171-202] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G-------------------ADFEIVGRY---VLE----------------------------------------------------------------------DPARISQWAQYRPT-CFETP----------------------------------------------------------------
21 HHSearch 21.0642% -7 - C4 -4B4P - ? A:[30-55] --------------------------------------------------------------------------------------------------------WQ------------HQIY-----NVNF---IP-----------------SS---SGT--LTC----------------QAGTIL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 20.7418% 30 * C8 *3FVC - GB_EBVB9 A:[66-106] --------------------------------------------------------------------------------------------------N----IIP------------Y-SF-----KVRSYTKIVT-----NILIYNGHRADSV---TNR--HEE----------------KFSVD---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 20.6431% 56 * C9 *3UGQ - SYTM_YEAST A:[104-141] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------WENY-------------------------------ADDMFKVE------TT-------------D-EEKEEYGL------KPM---------NCPG-HCL------IFGKK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------