@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : H2RBD_RBD: (2013-07-30 )
MGNVFFLLLFSLTHFPLAQQSRCTLTVGISSYHSSPCSPTQPVCTWNLDLNSLTTDQRLHPPCPNLITYSGFHKTYSLYLFPHWIKKPNRQGLGYYSPSYNDPCSLQCPYLGCQSWTCPYTGPVSSPSWKFHSDVNFTQEVSQVSLRLHFSKCGSSMTLLVDAPGYDPLWFITSEPTQ

Atome Classification :

(20 SA) -------------------------------.........10--..---.......20..---......30.------------.......40--.........50--.---....-....60------...-----.....70......-..80........90---------------------------.........100.....--..---110.---------...----...-------120--....---....------130..-------..---...140-...-------------------------..----....150-.....---------....160..-.....170......-------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------MGNVFFLLLF---SL---THFPLAQQSRC---TLTVGISSY------------HSSPCSPT---QPVCTWNLDL---N---SLTT-DQRLHP------PCP-----NLITYSGFHKTYS-LYLFPHWIKKPNR----------------------------QGLGYYSPSYNDPCSLQ--CP---YLGC---------QSW----TCP-------YT---GPVS---SPSW------KFHSD-------VN---FTQE---VSQ-------------------------VS----LRLHF---SKCGS---------SMTLLVDAP-GYDPLWFITSEPTQ-------------
15 Fugue 66.7519%-103 - C10 -1AOL ENV_MLVF5 A:[1-227] -------------------QVYNITWEVTNGDRETVWAISG---NHPLWTWWPVLTPDLC---MLALSGPPHWGLEYQAPYSSPPGPPCCSG---SSGSSAGCSR---D---CDEP-LTSLTP------RCNTAWNRLKLDQVTHKSSEG-FYVCP---------------------------------------GSHRPREAKSCGGP--DS---F-YC---------ASW----GCE-------TT---GRVYWKPSSSWDYITVDNNLTT-------SQ---AVQV---CKD-------------------------NKWCNPLAIQF---TNAGKQVTSWTTGHYWGLRLYVS-GRDPGLTFGIRLRYQNLGPRV------
19 Fugue 66.4912% -75 - C7 -1SSQ CYSE_HAEIN A:[1-241] MNLDVWQHIRQEAKELAENEPMLASFFHSTILKHQNLGGAL---SY---LLANKLANPIM---PAISLREII------------EEAYQSNP---SIIDCAACDI---Q---AVRHRDPAVEL------WST-----PLLYLKGFHAIQS-YRITHYLWNQNRK----------------------------SLALYLQNQISVAFDVD--IHPAAKIGH---------GIM----FDH-------AT---GIVV---GETS------VIEND-------VS---ILQG---VTLGGTGKESGDRHPKVREGVMIGAGAKIL----GNIEVGKYAKIGA---------NSVVLNPVP-EYATAAGVPARIVS-------------
26 HHSearch 64.6929% -72 - C6 -3MUU - ? A:[369-389] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NVPQI---------PYKALVERA-GYAPLNL--------------------
17 Fugue 59.0912% -67 - C7 -4FZL ? A:[1-239] -------------GMQNPVATVLLLQGDLYCSPNCLATFQD---QA---RRDSFGIQSKV---ALKTFAAAD------------QREAEGRD---LRTAYNEIAT---DIGRSQQI-NENIIK------YPP-----GNHVLSG-GLMTP-FHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVG--KD---SNAS---------WLTLGNITLR-------LV---GTIDKNASGAW------TFSGE-------IR---AFND---VYD-------------------------AN----PSNHR---GWLGE---------NLTSLLSAV-PFTSYSIEIPGSLPVTVSGN-------
11 Fugue 56.9218% -91 - C9 -2LU7 - A:[1-82] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MTRVR--ST---PGGD---------LEL----VVH-------LS---GPGG---PVRW------YKDGERLASQGRVQ---LEQA---GAR-------------------------QV----LRVQG---ARSGD---------AGEYLCDAP-QDSRIFLVSVEEP--------------
18 Fugue 56.1813%-100 - C9 -3ON9 - ? A:[161-320] ---------------------------------GSFNSIDV---EI---NMYPVNKTS-C---NSSIG----------------------SS---STISTSELTI---T---LTHE-D------------CT-----PVFIGDYYSVVDK-LATSGFFTNDKVH----------------------------QDL-------TTQCKIN--LE----IKC---------NSG----RES-------RQ---LTPT---TKVY------LMPHS-------ET---VTVVGDCLSN-------------------------LD----VYIVY---ANTDA---------I------YS-DMDVVAYHTSYILNVDHIPPNDCERD-
12 Fugue 53.3613% -66 - C5 -1L0V FRDB_ECOLI B:[1-243] ---AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLD---AL---GYIKDNLAPDL---SYRWSCRMA------------ICGSCGMMVNNVPKLACKTFL---R---DYTD-GMKVEALANFPIERD-----LVVDMTHFIESLEAIKPYIIGNSRTAD----------------------------QGTNIQTPAQMAKYHQFSGCI---NCGL---------CYA----ACPQFGLNPEFI---GPAAI--TLAH------RYNED-------SRDHGKKER---MAQ-------------------------LN----SQNGV---WSCTF---------VGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
1 PsiBlast_PDB 52.0521% -21 - C8 -4GVF NAGZ_SALTY A:[170-257] -----------------------------------------------------------------AVTADSH------------KETPCDPR---PETDIRGKDMSVFR---TLIS-ENKLDA------IMP-----AHVIYRAIDPRPA--SGSPYWLKTVLR----------------------------QELGFDGVIFSDDLSME--GA---AI-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 51.8221% -26 - C8 -4GVH NAGZ_SALTY A:[170-257] -----------------------------------------------------------------AVTADSH------------KETPCDPR---PETDIRGKDMSVFR---TLIS-ENKLDA------IMP-----AHVIYRAIDPRPA--SGSPYWLKTVLR----------------------------QELGFDGVIFSDDLSME--GA---AI-----------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 Fugue 49.3114% -91 * C7 *1COZ TAGD_BACSU A:[1-126] -------------------------------MKKVITYGTFDLLHW---GHIKLLERAKQLGDYLVVAISTD------------EFNLQKQK---KAYHSYEHRK---L---ILET-I----R------YVD-----EVIPEKNWE-------QKKQDIIDHNI----------------------------DVFVMG-DDW---------------------------------------------E---G-KF---DFLK---------DQ-------C-------E---VVY-------------------------LP----RTE------GIST---------TKIKEEI------------------------------
25 HHSearch 47.1650%-124 - C2 -3CX5 - UCRI_YEAST E:[128-152] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I--CT---HLGCVPIGEAGDFGGW----FCP-------CH---G-------------------------------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 45.1935% -84 - C11 -3F9Z SETD8_HUMAN A:[98-137] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VD---ATRE---TNR-------------------------LG----RLINH---SKCGN---------CQTKLHDID-GVPHLILIAS-----------------
5 PsiBlast_PDB 44.1335% -82 - C11 -1ZKK SETD8_HUMAN A:[99-138] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VD---ATRE---TNR-------------------------LG----RLINH---SKCGN---------CQTKLHDID-GVPHLILIAS-----------------
8 PsiBlast_PDB 43.9535% -79 - C11 -3F9W SETD8_HUMAN A:[98-137] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VD---ATRE---TNR-------------------------LG----RLINH---SKCGN---------CQTKLHDID-GVPHLILIAS-----------------
10 PsiBlast_PDB 42.9835% -80 - C11 -3F9Y SETD8_HUMAN A:[98-137] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VD---ATRE---TNR-------------------------LG----RLINH---SKCGN---------CQTKLHDID-GVPHLILIAS-----------------
4 PsiBlast_PDB 42.5035% -79 * C11 *2BQZ SETD8_HUMAN A:[93-132] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VD---ATRE---TNR-------------------------LG----RLINH---SKCGN---------CQTKLHDID-GVPHLILIAS-----------------
9 PsiBlast_PDB 42.2635% -80 - C11 -3F9X SETD8_HUMAN A:[98-137] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VD---ATRE---TNR-------------------------LG----RLINH---SKCGN---------CQTKLHDID-GVPHLILIAS-----------------
6 PsiBlast_PDB 37.9822% -74 - C8 -2BUJ - STK16_HUMAN A:[232-299] -------------------------------LGCVLYAMMF---GE---GPYDMVFQKGD---SVALAVQNQ--------------IPQSPR---HSSALWQLLN---S---MMTV-DPHQRP------HIP-----LLLS----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 37.2626% -56 * C9 *2AW2 - BTLA_HUMAN A:[19-79] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEHSILAGDPFELE--CP---VKYCANRPH----VTW----CKL-------NGTTCVKLE---D---------RQT----------S---WKEE---KNI-------------------------SF----FILHF---EP-------------------------------------------------
23 HHSearch 36.8730% -70 * C8 *3MST ? A:[20-61] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDV----GMP-------FS---GPVS---FPLL------VIEE----------------------E-------------------------LP----FRIHNIC-SETG----------KFDVVLDS-----------------------------