@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : HERVR_R: (2013-07-30 )
MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSVCDPGRGQPYVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSMEYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQPIWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQFRVFESFYEHVNQKLPEPPPLASNLFAQLAE

Atome Classification :

(16 SA) -------------------------------------------------------------------------------------.........10........20........30......------..40........50........60........70.......-------.80........90......----..---100.......110---.---------.-.......120....--...130--------------.....--...140------------....-------...------.150-------...-------------...-----..160........170....---------..-.180.......190----------..-------------......200.......210.........220.....-..230.......240--------.......250....--....260.......270.......280----------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------------------------------------------------------------MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWS------GNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSVCDPGRGQP-------YVCYDPKSSPGTWFEIHVG----SK---EGDLLNQTKVF-----P---------S-GKDVVSLYFDVCQI--VSMGS---------------LFPVI--FSSME-------------YYSS-------CHK------NRY--------AHP-------------ACS-----TDSP-VTTCWDCTTWSTNQQ---------SL-GPIMLTKIPLEPD-----------CK-------------TSTCNSVNLTILEPDQP--IWTTGLKAPLGARVSGE-EIGPGAYVYLYIIKK--------TRTRSTQQ-FRVFE--SFYEHVNQKLPEPPPLASNLFAQLAE-----------------------------------------
9 Fugue 74.2715% -62 - C5 -1TRK TKT1_YEAST A:[3-337] ------------------------------------------------------QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMN-PTNPDWINRDRFVLSNGH------AVALLYSMLHLTGYDLSIEDLKQF-RQLGSRTPGHPEFELP-------GV-EVTTGPLGQGISNAVG----MA---MAQANLAATYN-----K---------P-GFTLSDNY--TYVF--LGDGC---------------LQEGI--SSEASSLAGHLKLGNLIAIYDD-------NKI------TID--------GAT-------------SIS-----FDED-VAKRYEAYGWEVLYV---------EN-GN--EDLAGIAKA-----------IA-------------QAKLSKDKPTLIKMTTT--I---GYGSLHAGSHSVH-GAPLKADDVKQLKSK--------FGFNPDKS-FVVPQ--EVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQ---------------------
1 Fugue 73.5314% -48 - C7 -2WM9 A:[5-427] STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLH------RAYSKVTEVMHSGRRLLGTYFRVAFFGQGFF---EDEDGKE-------YIYKEPKLTPLSEISQRLL----KL---YSDKFGSENVK-----MIQDSGKVNPK-DLDSKYAYIQVTHV--IPFFD---------------EKELQERKTEFE-------------RSHN-------IRR------FMF--------EMPFTQTGKRQGGVEEQCK-----RRTI-LTAIHCFPYVKKRIP---------VM-YQHHTDLNPIEVA-----------ID-------------EMSKKVAELRQLCSSAE--VDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDD--------NKVKLLKEVFRQFV--EACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL-----------------------
5 Fugue 73.2416% -56 - C6 -3E4R ? A:[25-315] ------------------------------------------------------------------------------AAEPAQLRIGYQKAVSSLVLAKQHRLLEQR-----FPRTKITWV------EFPAGPQLLEALNVGSID--LGGAGDIPPLFAQA-AGADLL-------YVGWVPPTPKAETILVPSK----SALRTVADLKGKRIAF-----Q---------K-GSSAHNLLLRVLAKSGLSMRD---------------ITPLY--LSPAN-------------ARAA-------FAA------GQVDAWAIWDPWYS-------------ALT-----LDGS-ARLLANGEGLGLT--------------GGFFLSSRRYATA------------W-------------GPFVQQVMGTLNQADG----LLERDRAGSIKTLAQV-SGLPPAVVERTLAHRPPASVQPLSAQVIKAQ-QATAD--LFYA--QRLLPKRVLVAPAVW-RAPD-----------------------------------------
7 Fugue 73.0611% -71 - C7 -1K8K - ARPC2_BOVIN D:[1-283] -----------------------------------------------------------------------------------MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFD------G------VLYHISNPNGDKTKVMVSISLKFYKELQAHGADE-------LLKRVY----GSYLVNPES----GY---NVSLLYDLENL-----P---------A-SKDSIVHQAGMLKR--NCFAS---------------VFEKY--FQFQE-------------EGKEGENRAVIHYR------DDE--------TMY-------------VES-----KKDR-VTVVFSTVFKDDDDV---------VI-GKVFMQEFK---E-----------GR-------------RASHTAPQVLFSHREPP--LELKDTDAAVGDN---------IGYITFVLFPR--------HTNASARD-NTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPD-----------------------------
10 HHSearch 72.1318% -49 - C7 -1LCS ENV_FLVLB A:[4-204] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PHQVYNVTWTI-TN----LV---TGTKANATSML-----G---------TLTDAFPTMYFDLCDI--IGNTWNPSDQEPF-------PGYGC--DQPMR-------------RWQQ-------RNT------PFY--------VCP-------------GHANR---KQCG-GPQDGFCAVWGCETTGETYWRPTSSW-DYITVKKGVTQGIYQCSGGGWCGPCYDKAVHSSTTGASEGGRCNPLILQFTQKGRQ--TSWDG-PKSWGLRLYRS-GYDPIALFSVSRQVM-------------------------------------------------------------------------------------------
4 Fugue 55.649% -52 - C7 -2YIN - DOCK2_HUMAN A:[1196-1620] -------------------------SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLM----TQ---FPNAEKMNTTS-----A---------P-GDDVKNAPGQYIQC--FTVQPVLDEHPRFKNKPVPDQIINF--YKSNY-------------VQRF-------HYS------RPV--------RRG-------------TVD-----PENE-FASMWIERTSFVTAY---------KLPGILRWFEVVHMSQ-----------TT-------------ISPLENAIETMSTANEK--ILMMINQYQSDETLPIN-PLSMLLNGIVDPAVM--------GGFAKYEK-AFFTE--EYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
6 Fugue 54.3211% -42 - C7 -1DKZ - A:[1-215] -------------------------------------------------------------------------------------VLLLDVTPLSLGIETM---------------------------GGVMTTLIAKNTTIP---------TKHSQVFSTAEDNQ-------------------SAVSIHVLQGERKRAA---DNKSLGQFNLDGINPAP---------R-GMPQIEVTFDI---------D---------------ADGIL--HVSAK-------------DKNS-------GKE------QKI--------TIK---------------------------------ASSGLNED---------EI-QKMVRDAEANAEA-----------DR-------------KFEELVQTRNQGDHLLH--STRKQVEEA-GDKLPAD-DKTAIESALTALETA--------LKGEDKAA-IEAKM--QELAQVSQKLMEIAQ----------------------------------------------------
2 Fugue 51.739% -51 - C7 -1JDI - ARAD_ECOLI A:[1-223] -----------------------------------------------------------------------------------------MLEDLKRQVLEANLALPKHNL-------VTLTW------GNVSAVD------------------RERGVFVIKPSGVDYS-------IM----TADDMVVVSIETG----EV---VEGAKKPSSDT-----P---------T-HRLLYQAFPSIGGI--VHTHS---------------RHATI--WAQAG-------------QSIP-------ATG------TTH--------ADY-------------FYG-----TIPC-TRKMTDAEINGEYEW---------ET-GNVIVETFEK---------------Q-------------GIDAAQMPGVLVH--------------------------SHGPFAWGKNAED--------AVHNAIVL-EEVAY--MGIFCRQLAPQLPDMQQTLLNKHYLRKH---------------------------------------
11 HHSearch 51.4418% -41 - C7 -1AOL ENV_MLVF5 A:[87-223] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TPRC--NTAWN-------------RLKL-------DQVTHKSSEGFY--------VCP-------------GSHRPREAKSCG-GPDSFYCASWGCETTGRVYWKPSSSW-DYITVDNNLTTSQAVQV-------CKD------------NKWCNPLAIQFTNAGKQVTSWTTG--HYWGLRLYVS-GRDPGLTFGIRLRYQ--------NL---------------------------------------------------------------------------------
13 HHSearch 40.1023% 85 - C4 -1FWO - A:[5-31] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------DNF--------SCP-------------AGS-----TCSSAFGFRNLSLVWGC-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 HHSearch 29.1220% 58 - C7 -2DVJ - CRK_HUMAN A:[158-187] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ILRIRDKPEE--QWWNA--EDSE---GKR-GMIPVPYV--------------------------------------------------------------------------------------------------
8 Fugue 25.0725% 57 - C3 -3SSB - IMPI_GALME C:[6-40] ------------------------------------------------------------------------------------------------------------------------------------LICNGGHEYYECGGACDNVCADLHIQNKTNCPIIN-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 HHSearch 24.6217% 358 - C7 -2ID4 - KEX2_YEAST A:[468-485] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IDFHSWRLKLFGE-SIDSS-----------------------------------------------------------------------------------------------------
19 HHSearch 14.5017% 532 * C7 *4DQ9 - GSPH_VIBCH A:[29-40] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QDFGVRIDVD-TR--------------------------------------------------------------------------------------------------------
16 HHSearch 10.1818% 508 - C2 -4A1X - ? C:[8-18] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------YLLDGP-GYDPI-----------------------------------------------------------------------------------------------------
18 HHSearch 6.3220% 579 - C1 -3TVT - A:[206-215] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VA-QLYPVAVF--------------------------------------------------------------------------------------------------