@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : KoRVB_RBD: (2013-07-30 )
MLLISNPRHLGHPMSPGNWKRLIILLSCVFGGAEMNQQHNNPHQPMTLTWQVLSQTGSVVWEKKAVEPPWTWWPSLEPDVCALAAGLETWGIPHLTAPESQQSAPPDGCGVLYSQVGRGLVRQSSYGTLGCRCPRDRNRLAQSQFYVCPRDGRSLSEAWRCGGFESLYCKEWGCETTGTAYWQPRSSWDLITVGLGHPTGTCEHTGWCNPLKIEFTEPGKRFRNWLQGRTWGLRFYVTGHPGVQLTIRLVITSPPPVVVG

Atome Classification :

(19 SA) -----------------...-......10........20........30....-....40........50...-....-.60........70....-------------....80-...-..-...90........100--------.-------------------.-----......110...---------...--..120.......130..--------------.....140.------.--------...--------.---------.150...-....160.....--..170.......180........190..----..------------------------------------...----200---------.--...------------...---------------------..210.......220.......230.......240-....--..------------..250..-.....260---------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----------------MLL-ISNPRHLGHPMSPGNWKRLIILLSCVFGGAEM-NQQHNNPHQPMTLTWQVLS-QTGS-VVWEKKAVEPPWTWWPS-------------LEPDVC-ALA-AG-LETWGIPHLTAPESQ---------Q-------------------S-----APPDGCGV-LYS---------QVG--RGLVRQSSYGTLGCRCP--------------RDRNRLAQS------Q--------FYV--------C---------PRDGRSL-SEAWRCGGFESL--YCKEWGCETTGTAY-WQPRSSWDLITVG----LG------------------------------------HPT----G-----------T--CEH------------TGW---------------------CNPLKIEFTEPGKRFRNWLQGRTWGLRFYVTGH-P-GVQL--TI------------RLVITSP-PPVVVG-----------------------------------------
1 PsiBlast_PDB 97.4241% -81 - C2 -1AOL ENV_MLVF5 A:[1-227] --------------------------------------------------------------QVYNITWEVTN-GDRE-TVWAISGNHPLWTWWPV-------------LTPDLC-MLALSG-PPHWGLEY-QAPYSS---------P-------------------P-----GPPCCSGS-SGS---------SAG--CSRDCDEPLTSLTPRCN--------------TAWNRLKLD------QVTHKSSEGFYV--------C---------PGSHRP--REAKSCGGPDSF--YCASWGCETTGRVY-WKPSSSWDYITVD----NN------------------------------------LTT----SQAVQ-------V--CKD------------NKW---------------------CNPLAIQFTNAGKQVTSWTTGHYWGLRLYVSGRDP-GLTF--GI------------RLRYQNL-GPRV-------------------------------------------
14 HHSearch 93.4642% -85 - C2 -1AOL ENV_MLVF5 A:[1-228] --------------------------------------------------------------QVYNITWEVTN-GDRE-TVWAISGNHPLWTWWPV-------------LTPDLC-MLALSG-PPHWGLEYQAPYSSP---------P-------------------G-----PPCCSGSSGSSA---------GCS--RDCDEPLTSLTPRCNTA--------------WNRLKLDQVTHKSSEG--------FYV--------C---------PGSHRPR--EAKSCGGPDSF--YCASWGCETTGRVY-WKPSSSWDYITVD----NN------------------------------------LTTSQAVQ-----------V--CKD------------NKW---------------------CNPLAIQFTNAGKQVTSWTTGHYWGLRLYVSGR-DPGLTF--GI------------RLRYQNLGPRVP-------------------------------------------
4 Fugue 92.0141% -81 - C2 -1AOL ENV_MLVF5 A:[1-227] --------------------------------------------------------------QVYNITWEVTN-GDRE-TVWAISGNHPLWTWWPV-------------LTPDLC-MLA-LSGPPHWGLEYQAPYSSP---------P-------------------G-----PPCCS-GS-SGS---------SAGCSRDCDEPLTSLTPRCNTA--------------WNRLKLDQV------THKSSEG--FYV--------C---------PGSHRP--REAKSCGGPDSF--YCASWGCETTGRVY-WKPSSSWDYITVDNNLTTS------------------------------------QAV----Q-----------V--CKD------------NKW---------------------CNPLAIQFTNAGKQVTSWTTGHYWGLRLYVSGRDP-GLTF--GI------------RLRYQNL-GPRV-------------------------------------------
15 HHSearch 87.5338% -97 - C2 -1LCS ENV_FLVLB A:[4-208] ------------------------------------------------------------PHQVYNVTWTITNLVTGT-KANATSMLGTLTDAFPT-------------MYFDLC-DII-G---NTWNPSDQE------------------------------------------P-------------------------------FPGYGCDQP--------------MRRWQQRNT------P--------FYV--------C---------PGHANR-----KQCGGPQDG--FCAVWGCETTGETY-WRPTSSWDYITVK----KG------------------------------------VTQ----GIYQCSGGGWCGP--CYDKAVHSSTTGASEGGR---------------------CNPLILQFTQKGRQT-SWDGPKSWGLRLYRSGY-DPIALF--SV------------SRQVMTITP----------------------------------------------
2 PsiBlast_PDB 71.0335% -69 - C2 -1LCS ENV_FLVLB A:[56-208] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QEPFPGYGCDQP--------------MRRWQQRNT------P--------FYV--------C---------PGHANRK-----QCGGPQDG--FCAVWGCETTGETY-WRPTSSWDYITVK----KG------------------------------------VTQ----G-----------IYQCSG------------GGWCGPCYDKAVHSSTTGASEGGRCNPLILQFTQKGRQ-TSWDGPKSWGLRLYRSGY-D-PIALFSVS------------RQVMTIT-P----------------------------------------------
9 Fugue 58.1113% -47 - C3 -1QLT VAOX_PENSI A:[6-273] ---------------------EFRPLTLPPKLSLSDFNEFIQDIIRIVGSENV-EVISVDGSYMKPTH----T-HDPH-HVMDQDYFLASAIVAPR-------------NVADVQ-SIV-GL-ANKFSFPLWPISIGR---------N-------------------SGYGGAAPRVSGSV-VLD----------MG--KNMNRVLEVNVEGAYCVVEPGVTYHDLHNYLEANNLRDKL------W--------LDV--------P---------DLGGGSV-LGNAVERGVGYT--PYGDHWMMHSGMEV-VLANG--ELLRTG----MG------------------------------------ALP----D-----------P--KRP------------ETM---------------------GLKPEDQPWSKIAHLFPYGFGPYIDGLF-SQSN-M-GIVT--KI------------GIWLMPN-P----------------------------------------------
10 Fugue 57.1412% -52 - C3 -1VAO VAOX_PENSI A:[6-273] ---------------------EFRPLTLPPKLSLSDFNEFIQDIIRIVGSENV-EVISVDGSYMKPTHTHDPH-HVMD---QDYFL--ASAIVAPR-------------NVADVQ-SIV-GL-ANKFSFPLWPISIGRNSGYGGAAPR-------------------V---------SGSV-VLDMGKNMNRVLEVN--V--EGAYCVVEPGVTYH--------------DLHNYLEAN------N--------LRDKLWLDVPD----------LGG-GSV-LGNAVERGVGYT--------------PY-GDHWMMHSGMEVV----LANGELLRTGMGALPDPKRPETMGLKPEDQPWSKIAHLFPY----G-----------F-------------------------------------------------------------GPYIDGLFSQS-N-M-GIVT--KI------------GIWLMPN-P----------------------------------------------
13 Fugue 48.868% -56 * C4 *4HUD - VG15_BPT4 A:[3-234] -----------------------------GYFYNSSFRRYATLMGDLFSNIQI-KRQLESGDKFIRV---------------------------PI-------------TYASKE-HFM-MK-LNKWTSINSQEDVAK---------V-------------------E-----TILPRINL-HLV---------DFS--YNAPVVSQY----------------------NPSPIKMIY------E--------LSI--------F---------TRYEDDM-FQIVEQ--ILPY--FQPHFNTTMYEQFG-NDIPFKRDIKIVL----MS------------------------------------AAI----D-----------E--AID------------GRR---------------------RIEWSLTFEVNGWMYPPVDDAEG-LIRTTYTDF-H-ANTR--DL------------PDGEGVF-ESVD-------------------------------------------
8 Fugue 46.9910% -40 - C3 -2PY6 ? A:[15-409] DPLAMNDSFLAAADALAVDPMFGIPANVREVIARRGNATRLVILGTKGFGAHLMNVRHERPCEVIAAVDDFRY-HSGE-LYYGLPIISTDRFTELATHDRDLVALNTCRYDGPKR-FFD-QI-CRTHGIPHLNFEQAV---------RAFGLQGNVDYRVDDWGADIV-----RNIPAFQT-LAQ---------RLA--DDYSVQTLYAVLNFHLT--------------CEPEYYHEV------E--------RPY--------STLYFRSGLLRFSDSEKMVDCGASIGESLA--GLIGVTKGKFERVWMIEPDRINLQTLQN----VL------------------------------------RRY----T-----------D--TNF------------ASR---------------------ITVHGCGAGENTIRVPF-DLIDVRPIDDIIDDA-P-TFIKM-DIEGSELSALKGARRAISEHK-PKLAISAYHRSTDLLDLTNYILSIRPDYQIGLRHHTPDRWDTCLYFY
16 HHSearch 38.0933% -85 - C6 -3MBR - ? X:[217-238] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RLFVTGK-RWPMLY--EI------------RLTP--L-PH---------------------------------------------
18 HHSearch 33.5226% -44 * C6 *3NOK ? A:[248-267] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIFMTGK-LWPRLF--EV------------RLDVV--------------------------------------------------
17 HHSearch 31.5832% -26 - C6 -3NOL ? A:[238-257] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RLFVTGK-LWPKVF--EI------------TLTQR--------------------------------------------------
3 PsiBlast_PDB 30.0030% -9 * C1 *3UYO - ? D:[23-77] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SWDAPAVT----VD------------------------------------FYV----I-----------T--YGE------------TGG---------------------NSPVQ-EFTVPGSKSTATISGLSPGVDYTITVY-A-G--------------------------------------------------------------------------
23 HHSearch 27.0417% -24 * C2 *2PBD - PROF1_HUMAN P:[20-51] ---------------------------------------------------------------------AIVG-YKDSPSVWAAVPGK----TFVN-------------ITPAEVGVLV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 22.6725% 50 - C1 -1FWO - A:[6-31] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D--------NFS--------C---------PA--------GSTCSSAFGFRNLSLVWGC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 Fugue 20.1747% 95 * C3 *2LCO - ? A:[1-19] -------------------------------------------------------------------------------------------GWWLA-------------LAP----ALA-LA-LALWWA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 HHSearch 10.6027% 149 * C5 *4FU6 PSIP1_HUMAN A:[24-45] --------------------------------------------------------------------------KPGD-LIFAKMKGYP---HWPA-------------RVDE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 HHSearch 8.7329% 197 - C4 -2RPS - ? A:[2-15] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V------Q--------ILR--------C---------PDGMQML-R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 7.7526% 122 - C5 -2DAQ - A:[10-32] --------------------------------------------------------------------------HYKQ-IVWVKLGNY---RWWPA-------------EICNP-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------