@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PERVA_PRR: (2013-07-30 )
MHPTLSRRHLPIRGGKPKRLKIPLSFASIAWFLTLSITPQVNGKRLVDSPNSHKPLSLTWLLTDSGTGININSTQGEAPLGTWWPELYVCLRSVIPGLNDQATPPDVLRAYGFYVCPGPPNNEEYCGNPQDFFCKQWSCITSNDGNWKWPVSQQDRVSYSFVNNPTSYNQFNYGHGRWKDWQQRVQKDVRNKQISCHSLDLDYLKISFTEKGKQENIQKWVNGISWGIVYYGGSGRKKGSVLTIRLRIETQMEPPVAIGPNKGLAEQGPPIQEQRPSPNPSDYNTTSGSVPTEPNITIKTGAKLFSLIQ

Atome Classification :

(20 SA) ---------------------.........10........--20...---.....30.......-.40.......---.50...-.....-60--------......----..70.......-.80..-------.-------------.....90------....------------....-100------------------------------------------..-------------.....110---.------......--..--120..------..-....130---------------------...--------..---.----...140--.....-------..150....-----.---..160....---...170........180.........190......-.200.-......------------210.----......220-----------------------....-....230.....-..240.-------..---....250..------------.--....------260...-....270..-.....280.......290.......--300------.......-..----------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------------------MHPTLSRRHLPIRGGKPKR--LKIPL---SFASIAWFLTLSIT-PQVNGKRLVD---SPNSHK-PLSLT-WL--------LTDSGT----GININSTQGEA-PLGTW-------W-------------PELYVCL------RSVI------------PGLN-DQA------------------------------------------TP-------------PDVLRA-----Y------GFYVCP--GP--PN-NE------EY-CGNPQ-----------------------DFF--------CK---Q----WSCITS--NDGNW-------KWPVSQQDR-----V---SYSFVNNPT---SYNQ-FNYGHGRWKD--WQQRVQKDVRNKQISCHS-LDLDY-LKISFT------------EKGK----QENIQKWV------------------------NGIS-WGIVYYGGSGRK-KGSVLT-------IR---LRIETQMEP------------P--VAIG------PNKGLA-EQGPPIQEQ-RPSPNPSDYNTTSGSVPTEPNITIK--T--------GAKLFSL-IQ----------
14 HHSearch 94.8938% -92 - C9 -1AOL ENV_MLVF5 A:[1-228] -----------------------------------------------------------------------------------Q-VYNIT-WE--------VTN-GD----RETVWAISGNH-PLWTW-------W-------------PVLTPDL------CMLALSG---------PPHW-GLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPLTSLTPRCNTAWN-------------RLKLDQ-----VTHKSSEGFYVCP--GS--HRPREA-----KS-CGGPD-----------------------SFY--------CA---S----WGCETT--GRVYW-------K-PSSSWDY-----I---TVDNNLT------TSQ-AV-----------------------QVCKDNKWCNP-LAIQFT------------NAGK----QV--TSWT------------------------TGHY-WGLRLY-VSGRD-PGLTFG-------IR---LRYQN-LGP------------R--VP---------------------------------------------------------------------------------
1 PsiBlast_PDB 87.3427% -64 - C9 -1LCS ENV_FLVLB A:[4-208] ---------------------------------------------------------------------------------PHQ-VYNVT-WT--------ITNLVT----GTKANATSMLG-TLTDA-------F-------------PTMYFDL------CDIIGNTWNPSDQEPFPGYGCDQP------------------------------------------MR-------------RWQQRN-----T------PFYVCP--GH--AN-RK------Q--CGGPQ-----------------------DGF--------CA---V----WGCETT--GETYW-------R-PTSSWDY-----I---T---VKKGV---TQGI-YQCSGGGWCGPCYDKAVHSSTTGAS---EG-GRCNP-LILQFT------------QKGR----QTS---WD------------------------GPKS-WGLRLY-RSGYD-PIALFS-------VS---RQVMT-ITP--------------------------------------------------------------------------------------------------
13 HHSearch 85.8730% -77 - C9 -1LCS ENV_FLVLB A:[4-208] ---------------------------------------------------------------------------------PHQ-VYNVT-WT--------ITNLVT----GTKANATSMLG-TLTDA-------F-------------PTMYFDL------CDII------------GNTW-NPS------------------------------------------DQEPFPGYGCDQPMRRWQQRN-----T------PFYVCP--GH--AN--R------KQ-CGGPQ-----------------------DGF--------CA---V----WGCETT--GETYW-------R-PTSSWDY-----I---TVKKGVTQG---IY-Q-C--SGGGWCG--PCYD-KAVHSSTTGASEG-GRCNP-LILQFT------------QKGR----QT---SWD------------------------GPKS-WGLRLY-RSGYD-PIALFS-------VS---RQVM-TITP--------------------------------------------------------------------------------------------------
6 Fugue 82.0624% -70 - C9 -1AOL ENV_MLVF5 A:[1-227] --------QVYNITWEVTNGDRETVWAISGNHPLWTWWPV--LTPDL---CMLALSGPPHWGLE-YQAPY--------SSPPGP-PCCSG-SS--------GSSAGC----SRDCDEPLTSL-TPRCN-------T-------------AWNRLKL------DQVT------------H-------------------------------------------------------------------KSS-----E------GFYVCP--GSHRPR-EA------KS-CGGPD-----------------------SFY--------CA---S----WGCETT--GRVYW-------K-PSSSWDY-----I---TVDNNLTTS---QAVQ-VCKDNK--------------------WC------NP-LAIQFT------------NAGK----QV--TSWT------------------------TGHY-WGLRLYVS-GRD-PGLTFG-------IR---LRYQN---------------------LG------PRV----------------------------------------------------------------------
2 PsiBlast_PDB 68.2335% -72 - C9 -1AOL ENV_MLVF5 A:[109-221] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GFYVCP--GSHRPR-EA------KS-CGGPD-----------------------SFY--------CA---S----WGCETT--GRVYW-------K-PSSSWDY-----I---TVD--NNLT---T-----------------SQAVQVCKDNKWC--------NP-LAIQFT------------NAGK----Q--VTSWT------------------------TGHY-WGLRLY-VSGRD-PGLTFG-------IR---LRYQ-------------------------------------------------------------------------------------------------------
8 Fugue 65.8416% -18 * C8 *2X2Z AMA1_TOXGO A:[6-416] ------------GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDK---EVDGTLYREPAGLC-P-IWGKHIEL---QQPDRP-PYRNN-FLEDVPTEKEYKQSGNPLPGGFNLNFVTPSG-QRISP-------FPMELLENSNIKASTDLGRCA------EFAFKTVAMDK-----NNKA-TKY------------------------------------------RY-------------PFVYDSKKRLCH------ILYVSM--QL--ME-GK------KY-CSVKG-----------------------EPP--------DL---T----WYCFKPRKSVTEN-------HHLIYGSAY-----VGENPDAFISKCP---NQAL-RGYRFGVWKK--GRCLDYTELTDTVIERVE-SKAQC-WVKTFENDGVASDQPHTYPLTS----QASWNDWWPLHQSDQPHSGG------------VGRN-YGFYYVDTTGEG-KCALSD-------QVPDCLVSDSAAVS------------Y--TAAGSLSEETPNFIIP-SNTPPTPET-ALQCTADKFPDSFGACDVQACKRQK--TSCV-----GGQIQST-SVDCTADEQNEC
11 Fugue 58.7513% -44 * C10 *1X7F - ? A:[1-361] MERKLGISLYPEHSTKEKDMAYISAAARHGFSRIFTCLLS--VAEFK---EIINHAKDNNMEVI-LDVAPAVFYS---DLSFFA-ELGAD-GI--------RLDVGF---------DGLTEA-KMTNN-------P-------------YGLKIELNVSNDIAYLE------------NILS-HQA------------------------------------------NK-------------SALIGC-----H------NFYPQK--FT--GL-PY------DY-FIRCS-----------------------ERF--------KK---HGIRSAAFITS--HVANIGPWDINDGLCTLEEHRNLPIEV---QAKHLWATG---LIDD-VIIGNAYAS----------EEELEKLGNLN-RYMLQ-LKVHFV------------D---------EATEVE------------------------KRAT-LQELHVRRGDIT-EYMVRS-------TE---VRKKYKDYDFPVRESVLQERGQ--VVIG------NNSFGK-YKGE-LQII-LKEMPIDERKNIVGTIAEEELFLLDYVG--------AWTQFTC-VE----------
9 Fugue 54.5313% -7 - C7 -3FMC ? A:[4-368] ----------------------VDKHEVRVGELAAGQPLS--LPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHY-ELLGD-IS--------LVPLAN----PLGINQKSGEF-TLGRFDPITGVNW-------------NREYLDH------GFNI------------EVWY-QEH------------------------------------------SH-------------LDDDTL-----I------TAFRAT--LV--EE-CA------RR-LNNPWGVTTGHRLAVTLQSMAHRADIVLDLH--------TG---P----KSCKHL--YCPEY-------ERSAAQYFS-----I---PYTLLIPNS---FGGAMDEAAFVPWWT--LAEVASSHGRELGVRVSA-LTLELGSQERID------------LDDA----LEDAEGIL------------------------AYLSHRGVIAETVLPKPMKRYGCF-------LK---NYRKFHAPK------------AGMVEYL------GKVGVPMKATDPLVNL-LRLDLYGTGEELTVLRLPEDGVPIL--HFASASVHQGTELYKVMTKVFEL------
10 Fugue 50.319% -17 - C8 -3TOS ? A:[7-257] -------------------------QDLRAFV----HDSP--EETET---TQRLTKLLTNSPIP-TEELVNNLPL---FLRRHQMTDLLSMDA--------LYRQ---------VLDVPGVIMEFGVR-------F-------------GRHLGTF------AALR------------GVYE-PYN------------------------------------------PL----------------RRI-----V------GFDTFT--GF--PD-VN------DV-DRVGP-----------------------TAY--------QG---R----FA------VPGGY-------PAYLKEVLD-----A---HECSDFFGH---VTQR-SVLVEGDVRE--TVPRYLAENPQTVIALAY-FDLDL-----------------------------------------------------------------------------YEPTKA-------VL---EAIRPYLTK------------G--SIVA------FDELDN-PKWPGENIAMRKVLGLDHAPLRLLPGRPAPAYLRW--G--------D-------------------
15 HHSearch 48.0016% -7 * C9 *3PMS ? A:[178-314] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LP-------------TNTEKA-----Y------LRTTIS--GW--GH-AK---------PYDAG-----------------------SRG--------CA---E----W-CFRT--HTIAI-------N-N-----S-----N---TFQHQLGALGCSANPI-NNQSPGN------------WTPDRAGWCPG-MAVPT-RIDVLNNS----------LIGSTFSYEYKFQNWT------------------------NNGT-NGDAFY-------AISSFV-------IA---KSN-TPISA------------P--V----------------------------------------------------------------------------------
7 Fugue 46.9112% 33 - C7 -2HYX - DIPZ_MYCTU A:[-3-695] -------------------------------------EIR--EQLNL---GGIVNAQNAQLSNC-SDGAAQLESC---GTAPDL-KGITG-WL--------NTPGNK----PIDLKSLRGKV-VLIDF-------W-------------AYSCINC------QRAI------------PHVV-GWY------------------------------------------QA-------------YKDSGL-----A------VIGVHT--PE--YA-FE------KV-PGNVA-----------------------KGA--------ANLGIS----YPIALD--NNYAT-------WTNYRNRYW-----P---AEYLIDATG---TVRH-IKFGEGDYNV--TETLVRQLLNDAKPGVKL-PQPSS-TTTPDL------------TPRA----ALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLA-ANSFALRGRWAL-DYQGATSDGNDAAIK---LNYHAKDVY------------I--VVGG------TGTLTV-VRDGKPATL-PISGPPTTHQVVAGYRLASETLEVRPSK--------GLQVFSF-TYG---------
22 HHSearch 40.5442% 35 - C10 -3PWF - ? A:[136-167] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------KVYICPICGY--TA-VDEAPEYCPV-CGAPK-----------------------EKF--------V--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 38.9222% 27 * C6 *3FN9 - ? A:[434-509] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------YGHMDHPV---NLNA-DIQGMNRYFG--WYEKKIQDIK-PWVEQLE-KDYPY-QKLMLT------------EYGA----DANLAHQTEYLG--------------------DALN-WGKPFY------------------------------------------------------------------------------------------------------------------------------------
12 Fugue 37.5726% 50 - C3 -1P1P - ? ?:[1-25] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GCCG--SY--PN-AA------CHPCSCKD-----------------------RSY--------CG---Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 35.0019% -18 - C6 -1EJF - TEBP_HUMAN A:[61-110] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PN-DS------KH-KRTDR-----------------------SIL--------C-----------CLRK--GESGQ-------SWPRLTKER-----A---KLNWLS--V---DFNN--------WKD--WE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 31.1611% 45 - C5 -1PE4 - SCX12_CENNO A:[33-60] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AGSD-----------------------YGY--------CY---A----WTCYCE--HVAEG-------T-VL--WGD-----S------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 HHSearch 30.7820% 15 - C4 -1FWO - A:[6-32] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DNFSCP--AG--S-----------T-CSSAFGF---------------------RNL--------SL---V----WGCS-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 HHSearch 26.7923% 393 - C8 -2HB0 - CFAE_ECOLX A:[227-239] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S-LEIRFQ------------DDNS----KS-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 HHSearch 24.2629% 115 * C7 *1D0D - TAP_ORNMO A:[35-48] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SFWICP--ED--HT-GA------DY-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 HHSearch 20.2123% 380 - C1 -3RSN - A:[11-29] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ENGR-----------------------QLGEVELQCGICT---K----W----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------