@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PERVB_RBD: (2013-07-30 )
MHPTLSWRHLPTRGGEPKRLRIPLSFASIAWFLTLTITPQASSKRLIDSSNPHRPLSLTWLIIDPDTGVTVNSTRGVAPRGTWWPELHFCLRLINPAVKSTPPNLVRSYGFYCCPGTEKEKYCGGSGESFCRRWSCVTSNDGDWKWPISLQDRVKFSFVNSGPGKYKVMKLYKDKSCSPSDLDYLKISFTEKGKQENIQKWINGMSWGIVFYKYGGGAGSTLTIRLRIETGTEPPVAVG

Atome Classification :

(20 SA) --------........-------------.10........20........30----.------....-----...40........50........-60........70-......----..80........90...-----.---....100-------------------.-----------------------....----------...---.-------------110...--....---120-...---......130.......140.......-------------150-.--.......-160---------.....--------..----.170--------...-.....180.......190.......200--....-----...210.-..-------------------.--....220.......230...----....----------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------MHPTLSWR-------------HLPTRGGEPKRLRIPLSFASIAW----F------LTLT-----ITPQASSKRLIDSSNPHRPLSLT-WLIIDPDTGVTV-NSTRGV----APRGTWWPELHFCLRLI-----N---PAVKS---------------------T-----------------------PPNL----------VRS---Y-------------GFYCCP--GTEK---E---KYC---GGSGESFCRRWSCVTSNDGDWKWPIS-------------LQ--D--RVKFSFV-NS----------GPGKY--------KV----MKL---------YKD-KSCSPSDLDYLKISFTEKGKQENIQKWI--NGMS-----WGIVF-Y-KY-------------------G--GGAGSTLTIRLRIETGTEPP----VAVG----------------
30 HHSearch 86.7537% -79 - C4 -1AOL ENV_MLVF5 A:[1-228] -----------------------------------------------------------------------------------------QVYNIT-WEVTN-GDRETV-WAISGN----HPLWTWWPVLTPDLCML-----ALSGPPHWGLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPLTSLTPRCNTAWNRLK----------LDQ---VTHKSSE-------GFYVCP--GSHR---PREAKSC---GGPDSFYCASWGCETTGRVYWK-PSS-------------SW--D--YITVDNN-LT-----------TSQA--------V-----QVC---------KDN-K-----WCNPLAIQFTNAGKQV--TSWT--TGHY-----WGLRL-Y-VS-------------------G--RDPGLTFGIRLRYQNLG-PR----VP------------------
2 PsiBlast_PDB 81.8326% -83 - C4 -1LCS ENV_FLVLB A:[4-208] ---------------------------------------------------------------------------------------PHQVYNVT-WTITNLVTGTKA-NATSML----GTLTDAFPTMYFDLCDIIGNTWN---PSDQE---------------------P-----------------------FPGYGCDQPMRRWQQRN---T-------------PFYVCP--GHAN---R---KQC---GGPQDGFCAVWGCETTGETYWR-PTS-------------SW--DYITVKKGVT-QGIYQCSGGGWCGPCYD--------KA----VHS---------STT-GASEGGRCNPLILQFTQKGRQTS---WD--GPKS-----WGLRL-Y-RS-------------------G--YDPIALFSVSRQVMTITP--------------------------
29 HHSearch 79.2426% -72 - C4 -1LCS ENV_FLVLB A:[4-208] ---------------------------------------------------------------------------------------PHQVYNVT-WTITNLVTGTKA-NATSML----GTLTDAFPTMYFDLCDI-----I---GNTWNPSDQEPFPGYGCD--------QPM---------------------RRWQ----------QRN---T-------------PFYVCP--GHAN---R---KQC---GGPQDGFCAVWGCETTGETYWR-PTS-------------SW--D--YITVKKG-VT----------QGIYQCSGGGWCGPCYDKAVHS---------STT-GASEGGRCNPLILQFTQKGRQT---SWD--GPKS-----WGLRL-Y-RS-------------------G--YDPIALFSVSRQVM-TITP-------------------------
22 Fugue 69.3624% -55 * C4 *1AOL ENV_MLVF5 A:[1-227] --------QVYNITWE-------------VTNGDRETVWAISGNHPLWT--W----W------PVLTPDLCMLALSGPPHWGLEYQAPYSSPPGP--PCCSGSSGSSA-GCSRDC----DEPLTSLT--PRC-NTA-----W---NRLKL---------------------D-----------------------QVTH----------KSS---E-------------GFYVCP--GSHRPREA---KSC---GGPDSFYCASWGCETTGRVYWK-PSS-------------SW--D--YITVDNN-LT----------TSQAV--------QV----CK-----------DN-KWCNP-----LAIQFTNAGKQV--TSWT--TGHY-----WGLRL-Y-VS-------------------G--RDPGLTFGIRLRYQNLGPRV------------------------
1 PsiBlast_PDB 58.5035% -71 - C4 -1AOL ENV_MLVF5 A:[107-221] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S---E-------------GFYVCP--GSHRPREA---KSC---GGPDSFYCASWGCETTGRVYWK-PSS-------------SW--D--YIT---V-DN----------NLTTS--------QA----VQV---------CKDNKWCNP-----LAIQFTNAGKQ--VTSWT--TGHY-----WGLRL-Y-VS-------------------G--RDPGLTFGIRLRYQ------------------------------
25 Fugue 47.9913% -64 - C5 -4IOY - X:[11-268] TKRLDQIFVRPNPDTKRVPSTVFIHENGIRFQSPLRTDSRIDILFSNIKNLI----FQSCKGELIVV-----IHIHLKNPILM-GKKKIQDVQFY-REASEDELEQEQ-EERRKR----AALDKEFKYFADAIAEAS----N---GLLTV---------------------E-----------------------NTF------------RD---L-------------GFQGVP--NRSA---V---FCM---PTT--------DCLVQLIEPPFLVIN-------------LEEVE--ICILERV-QF----------GLKNF--------DM----VFV---------YKD-FNKPV-----THINTVPIESLDFLKQWL--TDM-------DIPY-T-V-------------------------STINLNWATIMKSLQDDP------------------------
24 Fugue 45.6913% -39 - C5 -3A25 - TYW2_PYRHO A:[29-301] ---------IKPRIRE-------------ILSKELPEELVKLLPKRWVRIGD----V------LLLP-----LRPELEPYKHRIAEVYAEVLGVK-TVLRKGDYELLYGSDTVTV----HVENGIKYKLDVAKIMF-----S---PANVK---------------------E-----------------------RVRM----------AKV---AKPDELVVDMFAGIGHLSLP--IAVY---G---K----------------AKVIAIEKD---PYT-------------FK--F--LVENIHL-NK----------VEDRM--------SA----YNM---------DNR-DFPGENIADRILMGYV-VRTHEFIPKAL--SIAK-----DGAII-H-YHNTVPEKLMPREPFETFKRIT--KEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS----------
23 Fugue 44.8713% -43 - C5 -3MTV - ? A:[1-203] ---------ADVYDIG-------------RGAVMYVAGGKVSWAPRGGNEVK----F------EPVP-----KELKLVANRLHTSFPPHHVVDMSKFTFITPGSGVSM-RVEYQYGCLPADTVPEGNCWWRLLDSL-----P---PEVQY---------------------K-----------------------EIRH----------ANQ---F-------------GY-------------Q---TKH---GVPGKYLQRR-----------------------------LQ--V--N-GLRAV-TD----------THGPI--------VI----QYF---------SVK-ES---------WIRHLKLVEEPSLPGFE--DLLR-----IRVEP-N-TS-------------------P--LAGKDEKIFRF------GSH----KWYG----------------
28 Fugue 44.6214% -36 - C4 -1BS4 DEF_ECOLI A:[1-168] -------SVLQVLHIP-------------D--------ERLRKVAKPVE---------------EVN-----AEIQRIVDDMFETMYAEEGIGLA-ATQVDIHQRIIV-IDVSEN----RDER---------LVLI-----N---PELLE---------------------K-----------------------SGET----------GIE---E-------------GCLSIP--EQRA---L---------------------------------VP-------------RA--E--KVKIRAL-DR----------DGKPF--------EL----EAD---------GLL-AICIQHEMDHLV----------------------------GKLF-M-DY-------------------L--SPLKQQRIRQKVEKLDRLKA----RA------------------
35 HHSearch 43.8424% -57 - C4 -1PE4 - SCX12_CENNO A:[12-52] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KFGCSGLGENNPTCN---HVCEKKAGSDYGYCYAWTCYCEHVAE----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 Fugue 42.9811% -43 * C6 *2Z1P - ? A:[31-325] -SELSKSSIVDKVELD-------------HTTLYQGEMTSIKVSFSDKENQKKPGDT------ITLT-----LPDALVGMTENDSSPRKINLNGL-GEVFIYKDHVVA-TFNEKV----ESNVNGHFSFGIKTLIT-----N---SSPNV---------------------I-----------------------ETDF----------GTA----------------------T--ATQR---L---TIE---GVRDYPFFYKVGDLAGESNQVRWFLNVNLNKSDVTEDISIA--D--RQGSGQQLNK----------ESFTF--------DI----VND---------KET-KYISLAEFEQQGYGKIDFVTDNDFNLRF--YRDKARFTSFIVRY-T-STITE----------------A--GQHQATFENSYDINYQLNNQ----DATNEKNTSQVKNVFVEGEA
31 HHSearch 33.0217% -43 * C5 *2D2A - SUFA_ECOLI A:[16-60] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QGLTLTPAAAIH-IRELVAKQPGM-----VGVRL-GVKQ-------------------T--GCAGFGYVLDSV--------------------------------
38 HHSearch 30.4022%-101 - C4 -2F4N - Y1651_METJA A:[70-108] -------------------------------------------------------------------------------------------------------------------------AIPYFPP-SVHVAVI-----D---PT------------------------------------------------RKSI----------VIETKSG-------------YYLVGP--D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
37 HHSearch 29.8716% -25 - C4 -3R4Z - ? A:[308-353] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PEAVGFFRP----DDP-------I--SGIE-----WGLSHKY-DA-------------------SWNWNYLCFFKTRRQV-------------------------------
26 Fugue 27.2921% 44 - C5 -1E68 - ? A:[1-70] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MAKEFGIPAA-------------VA--G--TVLNVVE-AG----------GWVTT--------IV----SILTAVGSGGLSLLA-AAGRESIKAYLKKEIKKKGKRAVIAW-----------------------------------------------------------------------------------------
4 PsiBlast_PDB 18.4252% 153 - C7 -1DLK - ? B:[10-26] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSWPWQVS-------------LQ--D--KTGFHF--------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 18.1352% 135 - C7 -1KDQ - A:[10-26] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSWPWQVS-------------LQ--D--KTGFHF--------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 PsiBlast_PDB 18.0252% 135 * C7 *1YPH - ? C:[10-26] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSWPWQVS-------------LQ--D--KTGFHF--------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 PsiBlast_PDB 17.7752% 156 - C7 -1N8O - ? B:[10-26] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSWPWQVS-------------LQ--D--KTGFHF--------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 17.4152% 152 - C7 -1GG6 ? B:[10-26] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSWPWQVS-------------LQ--D--KTGFHF--------------------------------------------------------------------------------------------------------------------------------------------------------------------