@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : RDSU222: (2013-07-30 )
MKLPTGMVILCSLIIVRAGFDDPRKAIALVQKQHGKPCECSGGQVSEAPPNSIQQVTCPGKTAYLMTNQKWKCRVTPKISPSGGELQNCPCNTFQDSMHSSCYTEYRQCRRINKTYYTATLLKIRSGSLNEVQILQNPNQLLQSPCRGSINQPVCWSATAPIHISDGGGPLDTKRVWTVQKRLEQIHKAMTPELQYHPLALPKVRDDLSLDARTFDILNTTF

Atome Classification :

(20 SA) -----------------------------------------------------------------------..-.......10.-.......----.20........30.....-..----.40...-.--....50........---60-..---.......---70.....-...-80-....--.--...--90------.-..--......100.-------------......110-----........-120....-...130...---....140--.......--.150.......160-..----....----.170.--......180.-----......190--------------...-.-...200........210---.---........220--------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----------------------------------------------------------------------MK-LPTGMVIL-C-SLIIVRA----GFDDPRKAIALVQKQHGK-PC----ECSGGQ-V--SEAPPNSIQQVTCP---G--KT---AYLMTNQ---KWKCRVT-PKI-SP-SGGE--L--QNC--P-------C-NT--FQDSMHSSCY-------------TEYRQCR-R-----INKTYYTA-TLLKIRS-GSLNEVQIL---QNPNQL---LQSPCRG--SINQPVCWSATAPI-HI----SDGG----GPLDT--KRVWTVQKRL-----EQIHKAMTP--------------ELQ-Y-HPLAL-PKVRDDLSL-----D---ARTFDILNTTF--------------
1 PsiBlast_PDB 77.4928% -32 - C8 -4BGQ CDKL5_HUMAN A:[179-271] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RSPELL---LGAPYGK--SVD---MWSVGCILGEL----SDGQPLFPGESEI--DQLFTIQKVLGPLPSEQM-KLFYS--------------NPR-F-HGLRF-PAVNHPQSL-----E---RRYLGILNSVL--------------
16 HHSearch 60.0817% 11 - C- -2XFC - ? B:[264-407] -------------------------------------------------------------------------------------------------------------------KC----NC-GGS-N--EGLTTTDKVINNCK---VDQCH---AAVTNHK---KWQ-YNS-PLV-PRNAELGDRK--GKIHIP-------F-------PLANVTCRVPKARNPTVTYGKNQVIMLL-YP----DHPTLLSY-RN-GEEP-NYQEE-WVM---HKKEVV---LTVPTE-----GLEVTWGNNEPY-KYWPQLS-----------------------------------------------------------------------------------------------------------
17 HHSearch 58.5318% -17 - C4 -2YEW - ? C:[197-336] -------------------------------------------------------------------------------------------------------------------KC----TC-GETVK--EGTATNKITLFNCDTAPK--CI---TYAVDNT---VWQ-YNS-QYV-PR-SEVT--EVKGKIHVPFPLTDSTC-AVSVAPEPQVTYRL-------------GEVEFHFHP-----MYPTLFSI-RSLGKDP-SHSQE-WID---TPMSKT---IQVGAE-----GVEYVWGNNNPV-RL----------------------------------------------------------------------------------------------------------------
11 Fugue 55.779% -37 - C8 -3ONQ ? A:[9-262] ------------------------------------------------------ADILDLLSGHTDDTTIERL-AFECLLTNMT-DDRVVSLMNILGWQGDFNCFAIGGV-------------PSAS-L--ASTSLAIRKAVRDL---G--GE---HVVIGTY---GTFLLAL-ACQMGA-VTPE--V--TCT--A-------VMPA--FSEDEPLYLS-------------PVRSGVA-G-----ASHALRETMFSLQAAP-ALSTPSRPL---RADELL---PERALLGDDYAREELYRNVYQVL-RG----ENPD----DPTYLTVSTFLKYGSSL-----ENTAKELNV--------------HPN-T-VRYRL-KRAAETTGW-----DATDPRDAYVLTTALAIGRMRDR------
4 Fugue 48.8112% -1 - C8 -2XQH - ? A:[23-280] -------------------------------SDAKASGEFSVAVGNGARATEKASTAVGSWAAADGKQSTALG-VGTYAYAN-A-STALGSV----AFVDNTATYGTAAGNRAKVDK----DATEGT-ALGAKATVTNKNSVALG---A--NS---VTTRDNE---VYIGYKT-G---TE-SDKT--Y--GTR--V-------L-GG--LSDGTRNSDA-------------ATVGQLN-R-----KVGGVYDD-VKARITV-ESEKQKKYT---DQKTSE---VNEKVEA--R--TTVGVDSDGKL-TR----AEGA--------T--KTIAVNDGLV-----ALSGRTDRI--------------DYA-V-GAIDG-RVTRNTQSI-----E---KNSKAIAANTRT-------------
3 PsiBlast_PDB 48.4737% -44 - C5 -3J0C - ? B:[200-236] --------------------------------------------------------------------------------------------------------------------C----ECGGTK-I--SETINKTKQFSQCT---K--KEQCRAYRLQND---KW--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 Fugue 46.0812% 31 - C8 -3PF0 - ? A:[66-383] IVAVDISAETEKTYLTHVANDMVIPAYADAAKQSDLLHDLAQKHCQKAPVSGDELQALRDQWLVLAQAWASAEMVNFGPATA-SMSNLYINY----YPDERGLVHGGVADLITA-NP----ALTAEQ-L--AN---ESAVVQGIP---G--LE---EALYANDSLDAGQCAYVMSAS-SA-LGTR--L--KDI--E-------K-NW--QQNAIKLLAI-------------DKTAESD-Q-----GLNQWFNS-LLSLVETMKSNAIEQPLGLSGKAKGH---LPAATAG--QSRAIINAKLATLN-KAMTD-PVLT----AILGS--NNENTVADTL-----STALADTTA--------------LLA-QMPEDLA-TADKATQQE-----L---YDHLTNITRLIKSQLIPTLGIRVGF
10 Fugue 44.3913% 11 - C7 -2R2C - ? A:[36-180] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KSYKTW---DVPIAK---INIFAVA--EYTDTQKIKVTVKG-KI----LEGN----TLPKSM-VQVYLLEDKN-----HVLRGAVNGIWGEEFVNLKDYLYTYA-V-EPLSGMSFVAENYSIVAFVYD---VQTFEVYDVVHVKINPQS-------
8 Fugue 43.7210% -1 - C6 -3NBE ? A:[1-147] -------------------------------------------------------------------------------------------------SITPGTYNITNVAYTNR-LI----DLTGS-----NPAENTLIIGHHLN---K--TP---SG-YGNQ---QWTLVQL-PHT-TI-YTMQ--A--VNP--Q-------S-YV--RVRDDNLVDG-------------AALVGSQ-QPTPVSIESAGNSG-QFRIKIP-NLGLALTLP---SDANSTPIVLGEVDET--STNQLWAFESVSA--------------------------------------------------------------------------------------------------------------------
14 HHSearch 43.4021% 42 - C8 -4G1I PRGH_SALTY A:[64-91] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NKRI-----SIWLDTYYP--------------QLA-Y-YRIHF-DEPRKP-------------------------------------
13 HHSearch 42.5621% 53 - C8 -3GR0 - PRGH_SALTY A:[229-256] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NKRI-----SIWLDTYYP--------------QLA-Y-YRIHF-DEPRKP-------------------------------------
2 PsiBlast_PDB 41.6730% 3 - C3 -2JYV - A:[8-32] --------------------------------------------------------------------------------------------------------------------------------------------QFECP---DF-ST---CCVMVDG---SWGCCPM-PQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 HHSearch 40.5421% 36 - C8 -3GR1 - PRGH_SALTY A:[229-256] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NKRI-----SIWLDTYYP--------------QLA-Y-YRIHF-DEPRKP-------------------------------------
9 Fugue 36.6816% 38 - C8 -3E7K - TRPM7_RAT A:[2-55] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AG----SRVTF--ERVEQMSIQI-----KEVGDRVNY--------------IKR-S-LQSLD-SQIGHLQDL-----S---ALTVDTLKT----------------
20 HHSearch 33.3426% 144 * C8 *3H3G - B:[2-22] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K----SIQDL--RRRFFLHHLI-----AEIHTA------------------------------------------------------------------------
7 Fugue 32.5714% 14 - C8 -1G1J - NSP4_ROTS1 A:[1-43] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IEKQM-----DRVVKEMRR--------------QLEMI-DKLTT-REIEQVELL-----K---RIYDKLTVQ----------------
21 HHSearch 31.0838% 243 - C2 -3RLG - A1HA_LOXIN A:[67-79] ------------------------------------------------------------------------------------------------------------YTYHGI-PC----DCGRN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 Fugue 28.1426% 121 - C8 -1P5L RL1_HELPY A:[1-19] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AKKVSKRL-----EKLFSKIQN--------------DK-----------------------------------------------------
18 HHSearch 27.1350% 599 - C1 -4CPA - MCPI_SOLTU I:[10-23] ---------------------------------------------------------------------------------------------------------------CNK-PCKTHDDCSGAW-F-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 24.698% 54 - C8 -4EN6 HA70_CLOBO A:[59-109] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RQNQNL---GG--NI---SNNGCTA--IVGDLRIRETATPY-YY----PT---------AS--FNEEYIKNNV-----QNVF--------------------------------------------------------------------------