@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Xeno_PRR: (2013-07-30 )
MLVMEGSAFSKPLKDKINPWGPLIVMGILVRAGASVQRDSPHQIFNVTWRVTNLMTGQTANATSLLGTMTDTFPKLYFDLCDLVGDYWDDPEPDIGDGCRTPGGRRRTRLYDFYVCPGHTVPIGCGGPGEGYCGKWGCETTGQAYWKPSSSWDLISLKRGNTPKDQGPCYDSSVSSGVQGATPGGRCNPLVLEFTDAGRKASWDAPKVWGLRLYRSTGADPVTRFSLTRQVLNVGPRVPIGPNPVITDQLPPSQPVQIMLPRPPHPPPSGTVSMVPGAPPPSQQPGTGDRLLNLVQ

Atome Classification :

(20 SA) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10....-----....20-......-----..30.......-.40.-------.......---50......---..60.......--.-----70......------..80...---..---..-------------------------------.-------------------------------90------------------------------.--...-------.....100.......-110-----.------.......--120---...-..--..130----.......140...--....150...-.------...---160...--------.--------...170-.......180.......--190.......200......-..210--..---.....220......-.230.......240.......250.......260.......270------.......280.......290....------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MLVMEGSAFSKPLKD-----KINPWG-PLIVMG-----ILVRAGASVQR-DSPH-------QIFNVTW---RVTNLMTG---QTANATSLLGT--M-----TDTFPKLY------FDLCDLV---GD---YW-------------------------------D-------------------------------D-------------------------------P--EPD-------IGDGCRTPGGRRRTR-LY------D------FYVCPGH--TVP---IGC-GG--PGEGY----CGKWGCETTGQAY--WKPSSSWDLI-S------LKR---GNTPKD--------Q--------GPCYDS-SVSSGVQGATPGGRCNP--LVLEFTDAGRKA-SWDAPK-VWGLR--LY---RSTGADPVTRFSLT-RQVLNVGPRVPIGPNPVITDQLPPSQPVQIMLPRPPHPPPSGTV------SMVPGAPPPSQQPGTGDRLLNLVQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 HHSearch 96.7657% -74 - C3 -1LCS ENV_FLVLB A:[4-208] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PH-------QVYNVTW---TITNLVTG---TKANATSMLGT--L-----TDAFPTMY------FDLCDII---GN---TW-------------------------------N-------------------------------P-------------------------------SDQEPF-------PGYGCDQPMRRWQQR-NT------P------FYVCPGH--ANR---KQC-GG--PQDGF----CAVWGCETTGETY--WRPTSSWDYI-T------VKK---GVTQGIYQCSGGGWC--------GPCYDK-AVHSSTTGASEGGRCNP--LILQFTQKGRQT-SWDGPK-SWGLR--LY---R-SGYDPIALFSVS-RQVMTITP------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 96.1356% -76 - C3 -1LCS ENV_FLVLB A:[4-208] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PH-------QVYNVTW---TITNLVTG---TKANATSMLGT--L-----TDAFPTMY------FDLCDII---GN---TW-------------------------------NPS-----------------------------D-------------------------------Q--EPF-------PGYGCDQPMRRWQQR-NT------P------FYVCPGH--ANR---KQC-GG--PQDGF----CAVWGCETTGETY--WRPTSSWDYI-T------VKK---GVTQGI--------YQCSGGGWCGPCYDK-AVHSSTTGASEGGRCNP--LILQFTQKGRQT-SWDGPK-SWGLR--LY---RS-GYDPIALFSVS-RQVMTITP------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 Fugue 94.1544% -69 - C3 -1AOL ENV_MLVF5 A:[1-227] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVYNITW---EVTN-GDR---ETVWAISGNHP--L-----WTWWPVLT------PDLCMLALSGPP---HW-------------------------------GLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDE-------------------------------P--LTS-------LTPRCNTAWNRLKLD-QV------THKSSEGFYVCPGS--HRPREAKSC-GG--PDSFY----CASWGCETTGRVY--WKPSSSWDYI-T------VDN---NLT----------------------------TSQAVQVCKDNKWCNP--LAIQFTNAGKQVTSWTTGH-YWGLR--LY---VS-GRDPGLTFGIR-LRYQNLGPRV----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 HHSearch 92.4045% -71 - C3 -1AOL ENV_MLVF5 A:[1-228] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVYNITW---EVTN---G---DRETVWAISGNHPL-----WTWWPVLT------PDLCMLALSGPP---HW-------------------------------G-------------------------------LEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEP--LTS-------LTPRCNTAWNRLKLD-QVTHKSSEG------FYVCPGS--HRPREAKSC-GG--PDSFY----CASWGCETTGRVY--WKPSSSWDYI-T------VDN---NLTTSQ--------AV-------QVCKD-------------NKWCNP--LAIQFTNAGKQVTSWTTGH-YWGLR--LY---V-SGRDPGLTFGIR-LRYQNLGPRVP---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 90.8434% -69 - C3 -1AOL ENV_MLVF5 A:[1-228] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVYNITW---EVTN-GDR---ETVWAISGNHP--L-----WTWWPVLT------PDLCMLA---LSGPPHWGLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCD-------------------------------E-------------------------------P--LTS-------LTPRCNTAWNRLKLD-QV------THKSSEGFYVCPGS--HRPREAKSC-GG--PDSFY----CASWGCETTGRVY--WKPSSSWDYI-T------VDN---NLT----------------------------TSQAVQVCKDNKWCNP--LAIQFTNAGKQVTSWTTGH-YWGLR--LY---VS-GRDPGLTFGIR-LRYQNLGPRVP---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 Fugue 56.0419% -23 - C3 -3UP6 - ? A:[35-358] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TRAQLSIDLVNNVEQQE-----KINS--MRFIVFGSTPGGVRLDVNEHILL-STPETATDIDAQLLEVT----SSNDILVV---VIANEPQSLTS--Q-----LDGIANLLTLQEMIYDISSIL---NS---DG-------------------------------Q-------------------------------I-------------------------------I--SATGMPMTGVIRDISIAPDETKTVQMVI------E------RAVARVD--VFI---EAIDGG--AVTGY----TAG----STSVTL--HNFSHDSYFVMG------NVG---NGTRDN--------A--------DSSKNYGKVKEDVSESNLLTHSWT--AATTETWAYSSA-PGAENR-KLLCS--FYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIE-----------------------SV------TKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDW----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 Fugue 51.9820% -35 * C7 *4F1N - ? A:[12-1046] DTHAIYKVENRHDYGTKGTKVDILTNHILLAVGNDVPTEKIDKELVPKLDGWWKTAFIFTYHIDFKLSKPKKYELIEALLDEDEILYKYRDRIAFNGEDTIYSHVPLEEFTLFDGCWEEMVSQITLKFSGKVGLKDIYNDTTTQDTEVQESRMSAIDKTCLLSLLGAKFMSTDDLIFQVQGNKFFIFNNFAKAIPFQIGGYLLQGFTVSLTHVYGGVALNTVSVPAPFIKHTKYLPGDPRFKNNEKEQFTLMDWIIECYHQSKAIRDIRYNPKTAPPP-SVKDLN-----YFVEKNTDISA-LLKG-------LKVYRPYIN-RSSKGIVG---FTRESAVSMRN--T-----IDYFKRKY----------DIT---LK---YP-------------------------------D-------------------------------M-------------------------------K--LVN-------LGG--------------------------------KND--VVP---PEC-LTIVPGQKL----KGQIFDTKTYIDFSAIRPTEKFDLI-SRLSMPAIKR---GLTDSE--------N--------SAYQFM-RVPSRILDA-PVVQFKE--STFEYKDKSYGT-KHEESKGNWNMKGHQF---ISTPAKQVNLRAIF-INNANTAPPASMESELDISMDKFASDVKQLGVDFNVSGKPILIN------QFGPPIKPTFETSPGEISLLNLLENIPSNTYILYVLRRGNDSAVYDRLKYITDLKFGALNSCVVWDNFKKNSIQYNSNVVMKMNLKLLGSNHSLSIENNKLLIDKESNLPILVLGSDVTHYPEKDQNSIASLVGSYDDKFTQFPGDYMLQDGPGEEIITNVGSLMLNRLKIYQKHNNGKLPTKIMYFRDGVSVDQFSQVVKIEVKSIKESVRKFGPQLNGGNKYDPPVTCIATVKRNQVRFIPIQENAKNEKGEEVAVQSMGNVMPGTVVDRGITSVAHFDFFIQSHQALKGTGVPCHYWCLYDENQSTSDYLQEICNNLCYIFGRSTTSVKVPAPVYYADLLCTRATCFFKAGFELNMAQATVSKNVLLPQVNDNIKSVMYYI
9 Fugue 44.8810% -53 - C3 -3VQI ? A:[4-274] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MEEL-----RERVWN-GTINVE-----VVVSDAIVVPNTTLAD-------KSCHIVM---LRDAYLGF---YLPTVVRKLAD--TIKVPYESDYRNWW------FEYNGEG---VP----W-------------------------------E-------------------------------Y-------------------------------P------------------------CGV-LF------D------LLNKQMW--ELQ---LCH-GDKYPRGIL----PLVDGHSQIKDYW--RHQWKQACFI-L------NGS---AKR-----------------------------------------------IMSLSIPDFEN-FWVSIL-SRNRS--DF---MAVRSKLFS----M-NKAKSLPVRVWTSNYAVLQPTVPVTLSVAELLDSIKLSSVKSVIIQGIDVSIEDNIFELYDIFASIDGFLYLVTK-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 Fugue 44.4314% -77 - C6 -1PU1 - Y677_METTH A:[1-91] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MSLRKLTEGDLD-----EISSFL-HNTISD-----FILK------R-VSAK-------EIVDIDI---TVLVEYTDELKVDISAELYLDE--L-----SDADPGIV------DEAVDAA---YR---SL-------------------------------E-------------------------------S-------------------------------F--LDG-------FRE-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 Fugue 36.1113% 25 * C6 *1NLX - MPAP6_PHLPR A:[4-107] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ATTEEQK--LIEDVNASFR-A------AMATTANVPPAD--------K--------YKTFEA-AFTVSSKRNLADAVSKAPQLVPKLDEVYNAA-YNAAD-----------------HAAPEDKYEAF-VLHFSEALRIIAGTPEVHAV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 HHSearch 35.5448% 68 - C4 -3J20 - RS11_PYRFU M:[116-136] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------E-------------------------------D-------------------------------V--TPI-------PHDGTRPKGGRRGRR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 35.3945% 67 * C5 *2X04 - PABP1_HUMAN A:[2-32] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PLGSLTA------SMLASAPPQEQKQMLGERLFPLIQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
13 Fugue 31.4339% 10 - C7 -1FJN - DEFI_MYTGA A:[1-39] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GFGCP------------------N------NYQCHRHCKSIP---GRC-GG--YCGGWHRLRCTCYRCG----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 29.8423% 9 * C3 *3FVC - GB_EBVB9 A:[66-107] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N-IIPY--------SFKVRSYTKIVTNILIY---NGHRADSVTNR--H-----EEKFSVDS-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 HHSearch 28.4422% -8 - C2 -1FWO - A:[5-32] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------D------NFSCPAG--S-----TCSSAF--GFRNL----SLVWGCS----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 Fugue 26.6937% -8 - C6 -2LK9 - BST2_HUMAN A:[22-45] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LLLGIG-----ILVLL-IIVIL-GVPL-------IIFT---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 HHSearch 25.9336% 36 * C4 *4B4P - ? A:[30-54] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------WQH-------QIYNVNF---I---------------PSSSGT--L-----TCQAGTI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 HHSearch 17.6217% 117 - C3 -3GA2 - NFI_BACSU A:[109-120] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EP------D------VFLFDGN--GY--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 HHSearch 15.8214% 62 - C5 -2RPS - ? A:[2-15] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------V------Q------ILRCPDG--MQM---LR--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 HHSearch 11.8333% 195 - C3 -2W36 - NFI_THEMA A:[177-188] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A------P------IFVSPGH--LMD-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------