@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : friend_RBD: (2013-07-30 )
MACSTLPKSPKDKIDPRDLLIPLILFLSLKGARSAAPGSSPHQVYNITWEVTNGDRETVWAISGNHPLWTWWPVLTPDLCMLALSGPPHWGLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPLTSLTPRCNTAWNRLKLDQVTHKSSEGFYVCPGSHRPREAKSCGGPDSFYCASWGCETTGRVYWKPSSSWDYITVDNNLTTSQAVQVCKDNKWCNPLAIQFTNAGKQVTSWTTGHYWGLRLYVSGRDPGLTFGIRLRYQNLGPRVPIGPNPVLADQLSLPRPNPLPKPAKSPPASNSTPTLISPSPTPTQPPPAGTGDRLLNLVQ

Atome Classification :

(20 SA) -----------------------------------------------.........-----10.-------.......-------20........30........--40....--------...---.50..---..------...-------.--60........70........80---.........90..------------......100--------...--.....110.......120-------.........130.......140.......150.......160-.....----.--.170--..---......180.....--..190-------..--------.---.....200..--------..--------.--.-----.210...------------.-.---------------------..220.-......230.......240.-----......250.......260.......270--.......-------280.--------------......290.......300.....-----..310.......320...----....-------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----------------------------------------------MACSTLPKS-----PKD-------KIDPRDL-------LIPLILFLSLKGARSAAPGS--SPHQVY--------NIT---WEVTN---GD------RET-------V--WAISGNHPLWTWWPVLTPDLC----MLALSGPPHWGLE------------YQAPYSSP---------PGP--PCCSGSSGSSAGCSRD---------CDEPLTSLTPRCNTAWNRLKLDQVTHKSSEGFYVCPGSHRPR-EAKSC----G--GPD---SF---YCASWGCETTGRVY--WKPS--------SS--------W---DYITVDNNLT--------TS--------Q--A-----VQVCKDN------------K-W---------------------CNPLAI-QFTNAGKQVTSWTTGHYWGL-----RLYVSGRDPGLTFGIRLRYQNLGPRVPIG--PNPVLAD-------QLSL--------------PRPNPLPKPAKSPPASNSTPTLIS-----PSPTPTQPPPAGTGDRLL----NLVQ-------------------------------------------------------------------
14 HHSearch 99.57100% -94 - C9 -1AOL ENV_MLVF5 A:[1-228] --------------------------------------------------------------------------------------------------------------QVY--------NIT---WEVTN---GD------RET-------V--WAISGNHPLWTWWPVLTPDLC----MLALSGPPHWGLE------------YQAPYSSP---------PGP--PCCSGSSGSSAGCSRD---------CDEPLTSLTPRCNTAWNRLKLDQVTHKSSEGFYVCPGSHRPR-EAKSC----G--GPD---SF---YCASWGCETTGRVY--WKPS--------SS--------W---DYITVDNNLT--------TS--------Q--A-----VQVCKDN------------K-W---------------------CNPLAI-QFTNAGKQVTSWTTGHYWGL-----RLYVSGRDPGLTFGIRLRYQNLGPRVP--------------------------------------------------------------------------------------------------------------------------------------------------------------
5 Fugue 99.33100% -94 - C9 -1AOL ENV_MLVF5 A:[1-227] --------------------------------------------------------------------------------------------------------------QVY--------NIT---WEVTN---GD------RET-------V--WAISGNHPLWTWWPVLTPDLC----MLALSGPPHWGLE------------YQAPYSSP---------PGP--PCCSGSSGSSAGCSRD---------CDEPLTSLTPRCNTAWNRLKLDQVTHKSSEGFYVCPGSHRPR-EAKSC----G--GPD---SF---YCASWGCETTGRVY--WKPS--------SS--------W---DYITVDNNLT--------TS--------Q--A-----VQVCKDN------------K-W---------------------CNPLAI-QFTNAGKQVTSWTTGHYWGL-----RLYVSGRDPGLTFGIRLRYQNLGPRV---------------------------------------------------------------------------------------------------------------------------------------------------------------
15 HHSearch 71.0147% -97 - C9 -1LCS ENV_FLVLB A:[4-208] ------------------------------------------------------------------------------------------------------------PHQVY--------NVT---WTITNL--VT------GTK-------A--NATSMLGTLTDAFPTMYFDLC----DII---GNTWNPS------------DQEP-------------------------FP------------------------GYGCDQPMRRWQQ------RNTPFYVCPGHANR----KQC----G--GPQ---DG---FCAVWGCETTGETY--WRPT--------SS--------W---DYITVKKGVT--------QG--------IYQCSGGGWCGPCYDKAVHSSTTGASEGG-R---------------------CNPLIL-QFTQKGRQT-SWDGPKSWGL-----RLYRSGYDPIALFSVSRQVMTITP-----------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 70.2435%-107 - C9 -1LCS ENV_FLVLB A:[4-208] ------------------------------------------------------------------------------------------------------------PHQVY--------NVT---WTITNLVTGT------KAN-------A--TSMLGT--LTDAFPTMYFDLC----DIIGN---TWNPS------------DQEPF------------PG-----------------YG---------CDQPMRRWQQR-NTP----------------FYVCPG-HANR---KQC----G--GPQ---DG---FCAVWGCETTGETY--WRPT--------SS--------W---DYITVKKGVT------------------Q--G-----IYQCSGG------------G-WCGPCYDKAVHSSTTGASEGGRCNPLIL-QFTQKGRQ-TSWDGPKSWGL-----RLYRSGYDPIALFSVSRQVMTITP-----------------------------------------------------------------------------------------------------------------------------------------------------------------
7 Fugue 48.3116% -31 - C6 -1OXS - ? C:[1-352] -----------------------------------------------MVRIIVKNV-----SKVFKKGKVVALDNVNI-------NIENGERFGILGPSGAGKTT--FMRIIAGLDVPSTGELYFDDRLVAS---NG------KLIVPPEDRKI--GMVFQTWALYPNLTAFENIAF----PLTNMKMSKEEIR------------KRVEEVAKILDIHHVLNHFP--RELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSA-RALVKEVQSRLGVTLLVV--SHDPA-DIFAI----A--D---------------------RVG--VLVK--------GK--------L---VQVGKPEDLY--------DNP-------V--S-----IQVASLI------------G-E---------------------INELEG-KVTNEGVVIGS--------L-----RFPVSVSSDRAIIGIRPEDVKLSKDVIKD--DSWILVG-------KGKV--------------KVIGYQGGLFRITITPLDSEEEIF-----TYSDHPIHS----GEEVL----VYVRKDKIKVFEK----------------------------------------------------------
13 Fugue 47.2518% -23 - C6 -4GA6 AMPPA_PYRKO A:[1-493] MKAKIRILDMFSGRYTVLINEEDAKEAKLHPDDLVKIEAGKKAVYGSVALSNLVGKGEVGISRD-------VLDLHNFSEGETVSVIPAGTPESVRYIKKKMHGEKLRKVEIE--------AIV---RDIVD---RKLRDIEISSF-------V--TALEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVPIVAA---------AGLTIPKTSSRAITSAAGTAD---------VVEVFADVSFSLDEIKRIVEKVGACLVWGGALNLAPADDITI-KAERA----L--SID---P--------TGLMLASIMS--KKYA--------MG--------S---QYVLID--IP--------TG--------K--G-----VKV-ETV------------E-E---------------------ARSLAR-DFIELGKRL-----GQYVEV-----AITYGGQPIGHTVGPALEAREALSALMTGKGPGSLIEK-------ATGLAGILLEMGGVAPAGTGKKMAKEILESGKAWEKMKEIIEAQGGDPNIKPEEIPIGDKTYTFTAATSGYVTAIDNRAITAIARAAGAPEDKGAGIELYVKVGEKVKEGDPLFTIHAEHEARLDQAIVLARRTEPIRIE
12 Fugue 34.3022% -29 - C8 -1ZLD - ? A:[19-118] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GNIGQVD--IDSVILGRPGAIGS--------WELNNFITIGLNRV--------NA--------D--T-----VRVNIRN------------TGR---------------------TNRLIITQWDNTVTRGDVYELFGDYALIQGRGSFCLNIRSDTGRENWRMQLEN--------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 Fugue 32.759% -43 - C8 -2YGD - CRYAB_HUMAN A:[1-175] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDIAIHHP-WIRRPFFPFH--SPS---RL---FDQFFGEHLLESDL--FPTS--------TSLSPFYLRPP---SFLRAPSWFD--------TG--------L--S-----EMRLEKD------------R-F---------------------SVNLDV-KHFSP-EELKVKVLGDVIEV-----HGKHEERQDEHGFISREFHRKYRIPADVD--PLTITSSLSSDGVLTVNG--------------PRKQVSGPERTIPITREEKPAVTA-----APKK-----------------------------------------------------------------------------------------
16 HHSearch 32.5626% 23 - C4 -1FWO - A:[7-31] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NFSCPAG-------STC----SSAFGF---RN---LSLVWGC--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 Fugue 30.2610% -27 - C8 -1SMA - ? A:[1-123] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MRKEAIH--HRST--------DN--------F---AYAYDSETLH--------LRLQTKKNDVD--H-----VELLFGD------------P-Y---------------------EWHDGA-WQFQTMPMRKTGSDGLFDYW-----LAEVKPPYRRLRYGFVLRAG--GEKLVYT--EKGFYHE-------APSD--------------DTAYYFCFPFLHRV------------------------------------------------------------------------------------------------------------
6 Fugue 29.529% -17 * C8 *1BVZ - NEPU2_THEVU A:[1-120] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MLLEAIF--HEAK--------GS--------Y---AYPISETQLRVRLRAKKGDV--------V--R-----CEVLYAD------------R-Y---------------------ASPEEE-LAHALAGKAGSDERFDYFEA-----LLECSTKRVKYVFLLTGPQGEAVYFGETG--FSAERSK-------AGVF--------------QYAYIHRSE-----------------------------------------------------------------------------------------------------------------
11 Fugue 27.6211% 8 - C7 -1DIP T22D3_PIG A:[1-77] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MDLVKNHLMYAVREEVEILKEQIREL--VEKNSQL-------EREN--------------TLLKTLASPEQLEKFQSRLSPEEP-----APETPEAPEAPGGSAV-----------------------------------------------------------------------------
3 PsiBlast_PDB 27.5127% -8 - C7 -4B28 - ? A:[197-270] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AVDKVMLHGLRALQAQGFEIMDGEEVTE-KARSV----K--GPDEIRAM---RCASHACEVAVRKMEDFARS--------KV--------G---DGVTCENDI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 HHSearch 27.4226% 38 - C5 -1PE4 - SCX12_CENNO A:[34-60] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSD---YG---YCYAWTCYCEHVAE--GTV----------L--------W---GDS------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
17 HHSearch 26.5724% -22 - C6 -1SVB - A:[70-127] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VAARCPTMG-PATLAE----EHQGGTVCKRDQSDRGWGNHC----G--LFG---KGSIVACVKAACEAKKKA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 HHSearch 23.207% 19 * C7 *3FVC - GB_EBVB9 A:[347-360] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I-----TYFITSGGLLLAW----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 22.1920% 136 - C3 -3K9T - ? A:[81-97] ---------------------------------------------------------------------------------------------------------------------------------------SK------GEK-------VIDFKENNLHVM-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 HHSearch 14.1918% 138 - C1 -2RPS - ? A:[3-13] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QILRCPDGMQM----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 HHSearch 11.7320% 290 * C6 *2HB0 CFAE_ECOLX A:[225-239] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SSSLEI-RFQDDNSKS---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 0.0720% 478 - C2 -4GJH - TRAF5_MOUSE A:[465-474] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NIASGC-----PRFV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------