@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 5HT1E_HUMAN: (2016-01-08 )
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT

Atome Classification :

(23 SA) .........10........20........30........40........50........60........70........80...-...-..90........100.......110.......120.......130.---......140.......150....-.-.---.--160-----...-.----..-..----.170.....------..-180........190.......200.......210---------------.-----------------.------------.......220......-------.-----.------.-----------230-------------.----------------.---..-----..--------------.--------------.-----.-----240.---------------------.--.-.-------..-----.---.--------------------250-----------------.-------------------.-..-----------.-------------.-----------.-260-----.--..--------------.-.--.----------.-------------------.------270---..----------.----------.----------...------------------------------------------------------------------------------.--------------------.280..-----------.-------------....290.......300.......310......---.320....--...330.......340.......350.......360...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIV-MDR-WKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARK---RTAKRAALMILTVWTISIFISMP-P-L---F--W-------RSH-R----RL-SP----PPSQCTIQH------DH-V-IYTIYSTLGAFYIPLTLILILYYRIYHAAK-----------------S-----------------L------------YQKRGSSR--HLSNRS-------T-----D------S-----------Q---------------N----------------S---FA-----SC--------------K--------------L-----T-----QT-F---------------------C--V-S-------DF-----S---T--------------------SDP-----------------T-------------------T-EF-----------E-------------K-----------F-HA------S--IR--------------I-P--P----------F-------------------D------N-----DL----------D----------H----------PGE------------------------------------------------------------------------------R--------------------QQISST-----------R-------------ERKAARILGLILGAFILSWLPFFIKELIVGLSI---YTVSSEVA--DFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
1 PsiBlast_PDB 90.6044%-140 - C5 -4IAR C562_ECOLX A:[20-398] ---------------------KVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTV-TGR-WTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAK---RTPKRAAVMIALVWVFSISISLP-P-F---F--W-------R-Q-A---------------SECVVNT------DH-I-LYTVYSTVGAFYFPTLLLIALYGRIYVEAR-----------------SRIADLEDNWETLNDNLKV------------IEKADNAA--QVKDAL-------T-----K------M-----------R---------------A----------------A---AL-----DA--------------Q--------------K-----A-----TP-P---------------------K--L-E-------DK-----S---P--------------------DSP-----------------E-------------------M-KD-----------F-------------R-----------H-GF------D--IL--------------V-G--Q----------I-------------------D------D-----AL----------K----------L----------ANE------------------------------------------------------------------------------GKVKEAQAAAEQLKTTRNAYIQKYLAA-----------R-------------ERKATKTLGIILGAFIVCWLPFFIISLVMPI--------WFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFK---
3 PsiBlast_PDB 81.6128%-130 - C5 -4U15 ACM3_RAT A:[8-398] -----------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYII-MNR-WALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAK---RTTKRAGVMIGLAWVISFVLWAP-AIL---F--W-------QYFVG----KR-TV----PPGECFIQFL-----SE-P-TITFGTAIAAFYMPVTIMTILYWRIYKETE-----------------K-----------------MNIFEMLRIDEGGGSGGDEAE--KLFNQD-------V-----D------AAV---------R---------------G----------------I---LR-----NA--------------K--------------L-----K-----PV-YDSLDAVRRAALINMVFQMGETG--V-A-------GF-----T---N--------------------SLR-----------------M-------------------L-QQ-----------K-------------R-----------WDEA------A--VN--------------L-A--K----------S-------------------R------W-----YN----------Q----------T----------PNR------------------------------------------------------------------------------A--------------------KRVITTFRTGTWDAYLIK-------------EKKAAQTLSAILLAFIITWTPYNIMVLVNTFCD---SCIPKTYW--NLGYWLCYINSTVNPVCYALCNKTFRTTFKTL-------
68 HHSearch 80.1231%-136 - C5 -2RH1 ADRB2_HUMAN (first) A:[40-477] ---------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHIL-MKM-WTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFL-P-I---QMHW-------YRA-T----HQ-EAINCYAEETCCDFF------TN-Q-AYAIASSIVSFYVPLVIMVFVYSRVFQEAK-----------------R-----------------Q------------LNIFEMLR--IDEGLR-------L-----KIYKDTEGYYTIGIGHLLTK---------------S----------------PSLNAA-----KS--------------E--------------L-----DKAIGRNT-NGV-------------------I--TKD-------EA-----EKLFN--------------------QDVDAAVRGILRNAKLKPVYDSLDA---------------VRRA-----------ALINMVF-------Q-----------M-GETGVAGFTNSLRMLQQKRWDEAAVNLA-KSRW----------Y-------------------N------Q-----TP----------NRAKRVITTFRT----------GTW------------------------------------------------------------------------------D--------------------AYKFCL-----------K-------------EHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD---NLIRKEVY--ILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL----
71 HHSearch 79.8830%-138 - C5 -3PBL DRD3_HUMAN (first) A:[41-472] ------------------------YALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGV-WNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCP-L-L---FG-F-------NTT----------G----DPTVCSISN------P----DFVIYSSVVSFYLPFGVTVLVYARIYVVLK-----------------Q-----------------R------------RRKNIFEM--LRIDEGLRLKIYKD-----T------E-----------G---------------YYTIGIGHL--------L---TK-----SP--------------SLN------------AAKSELDKAIG-RNTN---------------------GVIT-K-------DE-----A---EKLFNQDVDAAVRGILRNAKLKPVYDSLDA-----------V-------------------R-RA-----------ALINMVFQMGETGVAGFTNSLRMLQQK-RW------D--EA--------------A-V--N----------L-------------------AKSRWYNQ-----TPN---------RAKRVITTFR-T----------GTW------------------------------------------------------------------------------D--------------------AYGVPL-----------R-------------EKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQT--CHVSPELY--SATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC----
15 PsiBlast_PDB 79.3127%-141 - C5 -4NC3 C562_ECOLX A:[38-414] ----------------------------MVIIPTIGG--NTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIM-FEAMWPLPLVLCPAWLFLDVLFSTASIWHLCAISVDRYIAIKKPIQANQY---NSRATAFIKITVVWLISIGIAIPVP-I---K--G-------IET------VD-NP----NNITCVLTK------ER-FGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAADLEDNWETLNDNLK-----------------V------------IEKADNAA--QVKDAL-------T-----K------M-----------R---------------A--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KD-----------F-------------R-----------H-GF------D--IL--------------V-G--Q----------I-------------------D------D-----AL----------K----------L----------ANE------------------------------------------------------------------------------GKVKEAQAAA-----------EQLKTT-----------RNAYIQKYLQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQMLL--EIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYR-
2 PsiBlast_PDB 79.0731%-159 - C5 -3SN6 R:[185-490] ----------------------MGIVMSLIVLAIV--FGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHIL-TKT-WTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFL-P-I---Q--M-------HWY-R--------Q----EAINCYAEETCCDFFTN-Q-AYAIASSIVSFYVPLVIMVFVYSRVFQEAK-----------------R-----------------Q------------LQKIDKSEGR--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CL-----------K-------------EHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD---NLIRKEVY--ILLNWIGYVNSGFNPLIYCR-SPDFRIAFQELLC-----
7 PsiBlast_PDB 78.7231%-163 - C5 -3ZPQ ADRB1_MELGA A:[14-299] ----------------------MSLLMALVVLLIVAG--NVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFL-P-IMMHW--W-------RDE-DPQALKC-YQ----DPGCCDFVT------NR-A--YAIASSIISFYIPLLIMIFVALR-----------------------------------------V------------YREAKEQ--------------------------------------------------------------------------S-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RVMLM-----------R-------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR---DLVPDWLF--VAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA-----
67 HHSearch 78.5029%-131 - C5 -3RZE ENLYS_BPT4 (first) A:[9-443] ----------------------MPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLL-MSK-WSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKY---RTKTRASATILGAWFLSFLWVIP-I-L---G--W-------NH-----------R----REDKCETDF------YDVT-WFKVMTAIINFYLPTLLMLWFYAKIYKAVR-----------------Q-----------------H------------CNIFEMLR--IDEGLR-------L-----K------IY----------K---------------DTEGYYTIGIGHLLTKSP---SL-----NAAKSELDKAIGRNTNG--------------VITK--D-----EA-E---------------------K--L-F-------NQ-----D---V--------------------DAA-----------------VRGILRNAKLKPVYDSLDAVR-RA-----------A-------------LINMVFQMG---E-TG------V--AG--------------F-T--N----------SLRMLQQKRWDEAAVNLAKSRWYN---Q-----TP----------N----------RAKRVITTFRTGTW------------------------------------------------------------------------------D--------------------AYLHMN-----------R-------------ERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCK---NCCNEHLH--MFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHI----
56 Fugue 78.4729%-135 - C5 -2RH1 ADRB2_HUMAN (first) A:[36-477] -----------------DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHIL-MKM-WTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFL-P-I---Q--MHWYRATHQEA-I----NC-YA----EETCCDFFT------N--Q-AYAIASSIVSFYVPLVIMVFVYSRVFQEAK-----------------R-----------------Q------------LNIFEMLR--IDEGLR-------L-----K------I-----------YKDTEGYYTIGIGHLLT----------------K---SP-----SL--------------N--------------A-----A-----KS-E---------------------L--D-K-------AI-----G---R--------------------NTN-----------------G-------------------V-IT-----------K-------------D-----------E-AE------K--LF--------------N-Q--D----------V-------------------D------A-----AV----------R----------G----------ILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWD--------------------AYKFCL-----------K-------------EHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD---NLIRKEVY--ILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL----
6 PsiBlast_PDB 78.2231%-166 - C5 -4AMJ ADRB1_MELGA A:[14-299] ----------------------MSLLMALVVLLIVAG--NVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFL-P-IMMHW--W-------RDE-DPQALKC-YQ----DPGCCDFVT------NR-A--YAIASSIISFYIPLLIMIFVALR-----------------------------------------V------------YREAKEQ--------------------------------------------------------------------------S-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RVMLM-----------R-------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR---DLVPDWLF--VAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA-----
31 PsiBlast_CBE 78.1032%-125 - C5 -2YCY ADRB1_MELGA B:[14-297] ----------------------MSLLMALVVLLIVAG--NVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFL-P-I---M--M-------HWW-R----DE-DP----QALKC---------------------------------------------------------------------------------------------YQDPGCCD--FVTNRAYAI----A-----S------S-----------I---------------I----------------S---FY-----IP--------------L--------------L-----I-----MI-F---------------------V--A-------------------------------------------------------------L-------------------R-VY-----------R-------------E-----------A-KE------Q--IR---------------------------------------------------------------KI----------D----------R----------ASK------------------------------------------------------------------------------R--------------------KRVMLM-----------R-------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR---DLVPDWLF--VAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLAF----