@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 5HT2C_HUMAN: (2016-01-08 )
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV

Atome Classification :

(36 SA) .........10........20........30........40........50..-....---..60........---70........80........90........100.......110.......120.......130.......140.......150.......160...---....170.......180....-...190--......----.---200---......-..210-.---.---......220.......230.......240......----------------------------------.250..-----------------------------------.....---------------260-----------------..----------------------.-------------.------------------.------------------------.------------.-------.----------270----...--------.--------.-------------------------------------------------.---------------------------------------------.---------------------------------------------.----------------------------280---.---.-------..------------.---.--------..---------------.------290----------....--...300.......310.......320.......330.......340.......350-.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQ-NWPA---LSIVIIIIMTIG---GNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRF---NSRTKAIMKIAIVWAISIGVS-VPIPVI--GLRDEE----K---VF----VNNTTC-VLND--P---N---FVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALML----------------------------------LHGHTE-----------------------------------EPPGL---------------SL------------------DF----------------------L-------------K------------------C------------------------C------------K-------R----------N-T----AEE--------E--------N-------------------------------------------------S---------------------------------------------A---------------------------------------------N----------------------------P-----N---Q-------DQ------------N---A--------RR---------------R------KKK----------ERRP--RGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNV-FVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
1 PsiBlast_PDB 88.1447%-144 - C4 -4IB4 5HT2B_HUMAN (first) A:[30-416] ------------------------------------------------------HWAA---LLILMVIIPTIG---GNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIWHLCAISVDRYIAIKKPIQANQY---NSRATAFIKITVVWLISIGIA-IPVPIK--GIET----------N-----PNNITC-VLTK--ERFGD---FMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQK-----------------------------------------KDFRH----------GF------------------DI----------------------L-------------V------------------G------------------------Q------------I-------D----------D-A----LKL--------A--------N-------------------------------------------------E---------------------------------------------G---------------------------------------------K----------------------------V-----K---E-------AQ------------A---A--------AE---------------Q------LKT----------TRNAYIQKYLQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCD-SCNQTTLQMLLEI-FVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYR----------------------------------------------------------------------
2 PsiBlast_PDB 87.8447%-148 - C4 -4NC3 C562_ECOLX A:[30-416] ------------------------------------------------------HWAA---LLILMVIIPTIG---GNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIWHLCAISVDRYIAIKKPIQANQY---NSRATAFIKITVVWLISIGIA-IPVPIK--GIET-V----D---N-----PNNITC-VLTK--ERFGD---FMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRA------------------------------------------------KDFRH----------GF------------------DI----------------------L-------------V------------------G------------------------Q------------I-------D----------D-A----LKL--------A--------N-------------------------------------------------E---------------------------------------------G---------------------------------------------K----------------------------V-----K---E-------AQ------------A---A--------AE---------------Q------LKT----------TRNAYIQKYLQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCD-SCNQTTLQMLLEI-FVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYR----------------------------------------------------------------------
78 HHSearch 86.3733%-137 - C4 -3PBL DRD3_HUMAN (first) A:[41-472] --------------------------------------------------------YA---LSYCALILAIVF---GNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVS-CPLLF---GFNTTG---------------DPTVC-SISN--P---D---FVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKN----------------------------------IFEMLR-----------------------------------IDEGL---------------RLKIYKD-------------TE----------------------G-------------Y------------------YTIGIGHLLTKSPSLNAAKSELDKAI------------G-------R----------N-TNGVITKD--------E--------A-------------------------------------------------EKLFNQDVDAAVRGILRNAKLKPVYDSLDA----------------V---------------------------------------------RRAALINMVFQMGETGVAGFTNSLRMLQQK-----R---WDEAAVNLAKSRWYN-------Q---T--------PN---------------RAKRVI-TTF----------RTGT--WDAYGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTC---HVSPELYSA-TTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC-------------------------------------------------------------------------
75 HHSearch 82.2529%-126 - C4 -2RH1 ADRB2_HUMAN (first) A:[40-477] ----------------------------------------------------V-VGMG---IVMSLIVLAIVF---GNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTS-FLPIQM--HWYRAT----H---QEAINCYAEETC-CDFFTNQ---A---YAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIF----------------------------------EMLRID-----------------------------------EGLRL---------------KIYKDTEGYYTIGIGHLLTKSP----------------------S-------------L------------------N------------------------AAKSELDKAIG--R-------N----------T-N----GVITKDE----AEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL---R---------------------------------------------M---------------------------------------------L----------------------------Q-----QKRWD-------EA------------AVNLAKSR-----WYNQTPNRAKRV-----I------TTF----------RTGT--WDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDN----LIRKEVYIL-LNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL-------------------------------------------------------------------------
3 PsiBlast_PDB 81.2928%-127 - C4 -4IAR C562_ECOLX A:[9-396] ---------------------------------------------YIYQDSISLPWKV---LLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGR-WTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAK---RTPKRAAVMIALVWVFSISIS-LP-PFFWRQA---------------------SEC-VVNT--D---HIL-YTVYSTVGAFYFP-TLLLIALYGRIYVEARSRIAD----------------------------------LEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGF------------------DI----------------------L-------------V------------------G------------------------Q------------I-------D----------D-A----LKL--------A--------N-------------------------------------------------E---------------------------------------------G---------------------------------------------K----------------------------V-----K---E-------AQ------------A---A--------AE---------------Q------LKT----------TRNA--YIQKYLAARERKATKTLGIILGAFIVCWLPFFIISLVMPI-----WFHL--AIFDF-FTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFK------------------------------------------------------------------------
74 HHSearch 79.2626%-138 - C4 -3RZE ENLYS_BPT4 (first) A:[10-443] -------------------------------------------------------PLV---VVLSTICLVTVG---LNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMS-KWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKY---RTKTRASATILGAWFLSFLWV-IPILGW--NH------------------RREDKC-ETDF--Y---DVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIF----------------------------------EMLRID-----------------------------------EGLRL---------------KI------------------YK----------------------D-------------TEGYYTIGIGHLLTKSPSLN------------------------AAKSELDKAIGRNT-------N----------G-VI---TKD--------E--------A-------------------------------------------------E---------------------------------------------KLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGV----------------------------AGFT--N---SL------RM------------L---Q--------QKRWDEAAVNLAKSRWYN------QTPNRAKRVITTFRTGT--WDAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNC----CNEHLHMF-TIWLGYINSTLNPLIYPLCNENFKKTFKRILHI-------------------------------------------------------------------------
12 PsiBlast_PDB 77.1332%-155 - C4 -2Y03 ADRB1_MELGA A:[8-300] ----------------------------------------------------Q-QWEAGMSLLMALVVLLIVA---GNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRG-TWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH--WWRDEDPQALK---CY----QDPGCCDFVTN--R---A---YAIASSIISFYIPLLIMIFV-ALRVY-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R----------E-A----KEQ--------I--------R-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRV-------MLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF-----NRDLVPDWLFVAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA--------------------------------------------------------------------------
11 PsiBlast_PDB 76.9732%-155 - C4 -2Y02 ADRB1_MELGA A:[8-300] ----------------------------------------------------Q-QWEAGMSLLMALVVLLIVA---GNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRG-TWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH--WWRDEDPQALK---CY----QDPGCCDFVTN--R---A---YAIASSIISFYIPLLIMIFV-ALRVY-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R----------E-A----KEQ-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRV-------MLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF-----NRDLVPDWLFVAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA--------------------------------------------------------------------------
14 PsiBlast_PDB 76.7832%-151 - C4 -4AMJ ADRB1_MELGA A:[8-300] ----------------------------------------------------Q-QWEAGMSLLMALVVLLIVA---GNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRG-TWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH--WWRDEDPQALK---CY----QDPGCCDFVTN--R---A---YAIASSIISFYIPLLIMIFV-ALRVY-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R----------E-A----KEQ-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRV-------MLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF-----NRDLVPDWLFVAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA--------------------------------------------------------------------------
9 PsiBlast_PDB 76.7532%-155 - C4 -2Y00 ADRB1_MELGA A:[8-300] ----------------------------------------------------Q-QWEAGMSLLMALVVLLIVA---GNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRG-TWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH--WWRDEDPQALK---CY----QDPGCCDFVTN--R---A---YAIASSIISFYIPLLIMIFV-ALRVY-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R----------E-A----KEQ-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRV-------MLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF-----NRDLVPDWLFVAFNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA--------------------------------------------------------------------------