@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 5HT5A_HUMAN: (2016-01-08 )
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150---.......160.......170.......180-------...---..-.------.190..-..--.--.---------.-200.......210.......220.......230------------------------------------.......--..240----------------------.-------------------------------.----------------.------------------------.----------.----.------------------------------------.-------------250----...-----------------------------.--------------------.---------------------------------------------.------------------------..-----.-----260--..---.------------------.--------------.---------------....--------------270------------.....-----------------------------..--------------------------------------------.280.......290.......300.......310-.......320-----.......330.......340.......350.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLR---TRKCVSNVMIALTWALSAVISLAPLLFGWG-------ETY---SE-G------SEECQV-SR--E--P---------S-YAVFSTVGAFYLPLCVVLFVYWKIYKAAKFR--------------------------------------VGSRKTN--SVSPI----------------------S-------------------------------E----------------A------------------------V----------E----V------------------------------------K-------------D------SAK-----------------------------Q--------------------P---------------------------------------------Q------------------------MV-----F-----T----VR---H------------------A--------------T---------------VTFQ--------------PE-------------GDTWR-----------------------------EQ--------------------------------------------KEQRAALMVGILIGVFVLCWIPFFLTELISPLCS-CDIPAIWKSI-----FLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
1 PsiBlast_PDB 94.3633%-150 - C2 -4IAR C562_ECOLX A:[21-394] ----------------------------------------VLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGR-WTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAK---RTPKRAAVMIALVWVFSISISLPP--FFWR-------QA---------------SECVV-NT--D--H---------ILYTVYSTVGAFYFPTLLLIALYGRIYVEARSR--------------------------------------IADLEDNWETLNDN----------------------L-------------------------------K----------------V------------------------I----------E----K------------------------------------A-------------D------NAA-----------------------------Q--------------------V---------------------------------------------K------------------------DA-----L-----TK---MR---A------------------A--------------A---------------LDAQKATPPKLEDKSPDSPE-------------MKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLAA-----------------------------RERKATKTLGIILGAFIVCWLPFFIISLVMPI---------WFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFK-
37 HHSearch 92.6134%-136 - C2 -3PBL DRD3_HUMAN (first) A:[41-472] ------------------------------------------YALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPL-LFGFN-------TTG------D------PTVCSI-SN-----P---------D-FVIYSSVVSFYLPFGVTVLVYARIYVVLKQR--------------------------------------RRKNIFE--MLRIDEGLRL-----------------K-------------------------------IYK--------------D------------------------T----------E----GYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK-------------D------EAE-----------------------------KLFNQDVDAAVRGILRNAKLKP---------------------------------------------VYDSLDAVRRAALINMVFQMGETGVAGFTNSLR-----M----LQ---Q------------------K--------------RWDEAAVNLAKSRWYNQTPNRAKRVITTFRTG--TW-------------DAYGV-----------------------------PL--------------------------------------------REKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSA-----TTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC--
49 Fugue 90.3327%-142 - C2 -2RH1 ADRB2_HUMAN (first) A:[36-477] -----------------------------------DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKM-WTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC---YA-E------ETCCDF-FT--N--Q---------A-YAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSE--LDKAIGRNTNGVITKDEAEKLFNQDVDA-------------------------------A----------------V------------------------R----------G----I------------------------------------LRNAKLKPVYDSLDA------VRR-----------------------------A--------------------A---------------------------------------------L------------------------IN-----M-----V----FQ---M------------------G--------------E---------------TGVA--------------GF-------------TNSLR-----------------------------MLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD-NLIRKEVYIL-----LNWIGYVNSGFNPLIY-CRSPDFRIAFQELLCL--
32 HHSearch 90.2827%-128 - C2 -2RH1 ADRB2_HUMAN (first) A:[40-477] ---------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFLPIQMHWY-------RAT---HQ-EAINCYAEETCCDFFT--N--Q---------A-YAIASSIVSFYVPLVIMVFVYSRVFQEAKRQ--------------------------------------LNIFEML--RIDEG----------------------LRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSE----------------L------------------------D----------KAIGRN------------------------------------T-------------NGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVR-------------------RAALINMVFQMGETGVAGFTNSL-----------------------RMLQQKRWDEAAVNL----------AK-----S-----R----WYN--Q------------------T--------------PNRAKRVITT------FRTG--------------TW-------------DAYKF-----------------------------CL--------------------------------------------KEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD-NLIRKEVYIL-----LNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL--
3 PsiBlast_PDB 87.9529%-144 - C2 -2YCW ADRB1_MELGA A:[17-298] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAK------------------------------------------------------------------------------------------------------------E----------------Q------------------------I----------R----K------------------------------------I-------------D------RAS-----------------------------K--------------------R---------------------------------------------K------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLAF--
5 PsiBlast_PDB 87.6429%-144 - C2 -2YCZ ADRB1_MELGA A:[17-298] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAK------------------------------------------------------------------------------------------------------------E----------------Q------------------------I----------R----K------------------------------------I-------------D------RAS-----------------------------K--------------------R---------------------------------------------K------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLAF--
9 PsiBlast_PDB 87.6029%-153 - C2 -2Y02 ADRB1_MELGA A:[17-300] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAKEQ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA---
7 PsiBlast_PDB 87.5929%-153 - C2 -2Y00 ADRB1_MELGA A:[17-300] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAKEQ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA---
2 PsiBlast_PDB 87.5429%-150 - C2 -2VT4 ADRB1_MELGA A:[17-298] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAK------------------------------------------------------------------------------------------------------------E----------------Q------------------------I----------R-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA---
10 PsiBlast_PDB 87.3329%-154 - C2 -2Y03 ADRB1_MELGA A:[17-300] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAKEQ--------------------------------------I--R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA---
6 PsiBlast_PDB 87.1729%-145 - C2 -2YCY ADRB1_MELGA A:[17-298] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAK------------------------------------------------------------------------------------------------------------E----------------Q------------------------I----------R-------------------------------------------------------D------RAS-----------------------------K--------------------R---------------------------------------------K------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLAF--
13 PsiBlast_PDB 87.0329%-147 - C2 -3ZPQ ADRB1_MELGA A:[17-300] ---------------------------------------------LMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGT-WLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWW-------R-----DE-D------PQALKC-YQ--D--PGCCDFVTNRA-YAIASSIISFYIPLLIMIFVALRVYREAKEQ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------RV-----M-----L----MR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR-DLVPDWLFVA-----FNWLGYANSAMNPIIYCR-SPDFRKAFKRLLA---