@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : AA1R_HUMAN: (2016-01-08 )
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Atome Classification :

(28 SA) .........10........20..---......30........40........50........60....-....70-.--.--...--...80........90........100.......110......---.120.......130.......140--..-.....150.......160.......170.......180--........190.......200.......210.....--.--------------------------------------------------------------------------------------------------------------------------------------.-------------------------------------------------------------------------------------------------------------------------------------------------220--------------....-.....230.......240.......250.......260.-......270.......280.......290.......300.......310.......320....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MPPSISAFQAAYIGIEVLIALVS---VPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPL-AILINI-G--P--QTY--FHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMV---VTPRRAAVAIAGCWILSFVVGLTP--MF-GWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMV---YFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSA--S--------------------------------------------------------------------------------------------------------------------------------------S-------------------------------------------------------------------------------------------------------------------------------------------------G----------------DPQK-YYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSC-HKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
79 HHSearch 97.2553%-171 - C5 -3EML ENLYS_BPT4 A:[22-468] ---------SVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQ-------SQGCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLNIFEML--RIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTW----------------------------------------------------------------------------------------------------------------------------------D----------------AYRS-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ----------------
2 PsiBlast_PDB 94.6451%-171 - C5 -3VGA AA2AR_HUMAN A:[6-308] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQ-------SQGCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVL------------------
1 PsiBlast_PDB 93.3651%-171 - C5 -3VG9 ? A:[6-309] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQ-------SQGCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR-----------------
5 PsiBlast_PDB 91.9950%-178 - C5 -4UG2 ? A:[6-309] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPF-AIAIST-G--F--CAA--CHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ARS-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR-----------------
3 PsiBlast_PDB 91.9950%-172 - C5 -2YDO ? A:[6-313] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPF-AIAIST-G--F--CAA--CHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMES------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYF--
8 PsiBlast_PDB 91.7650%-169 - C5 -3REY AA2AR_HUMAN A:[7-305] ---------SVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTP--ML-GWNNCGQP--------GCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS---------------------
6 PsiBlast_PDB 91.7350%-172 - C5 -4UHR AA2AR_HUMAN A:[6-313] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPF-AIAIST-G--F--CAA--CHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQPKEGKA---GCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDC-HAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAA-------
4 PsiBlast_PDB 91.5450%-174 - C5 -2YDV ? A:[6-313] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPF-AIAIST-G--F--CAA--CHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYFQ-
7 PsiBlast_PDB 91.3950%-168 - C5 -3PWH ? A:[7-305] ---------SVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTP--ML-GWNNCGQP--------GCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS---------------------
11 PsiBlast_PDB 90.7150%-169 - C5 -3UZC AA2AR_HUMAN A:[7-305] ---------SVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTP--ML-GWNNCGQP--------GCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS---------------------
9 PsiBlast_PDB 90.7150%-168 - C5 -3RFM AA2AR_HUMAN A:[7-305] ---------SVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTP--ML-GWNNCGQP--------GCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS---------------------
10 PsiBlast_PDB 90.5250%-169 - C5 -3UZA AA2AR_HUMAN A:[7-305] ---------SVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPF-AITIST-G--F--CAA--CHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTP--ML-GWNNCGQP--------GCGEGQVACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP--------------------------------------------------------------------------------------------------------------------------------------G-------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS---------------------
21 PsiBlast_CBE 88.4050%-180 - C5 -4UG2 ? B:[6-305] --------SSVYITVELAIAVLA---ILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPF-AIAIST-G--F--CAA--CHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTP--ML-GWNNCG-----------------ACLFEDVVPMNYMV---YFNFFACVLVPLLLMLGVYLRIFLAARRQLKQM----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------E----------------RARS-TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRS---------------------
82 HHSearch 78.8629%-145 * C5 *2RH1 ADRB2_HUMAN (first) A:[44-477] ------------GIVMSLIVLAI---VFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPF-GAAHIL-M--KMWTFG--NFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFLP--IQMHWYRATHQEAI-----N-CYAEETCCDFFT-NQAYA----IASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEML--RIDE-----------------------------------------------------------------------------------------------------------------------------------GLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTW----------------DAYK-FCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDN--LIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL---------------------
25 PsiBlast_CBE 76.1934%-167 - C5 -2YCW ADRB1_MELGA B:[13-296] -------------GMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVR-G--T--WLWGSFLCELWTSLDVLCVT-ASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH-WWRDEDP-----QALKCYQDPGC-CDF--VTNRAYAIASSIISFYI----PLLIMIFVALRVYREAKEQI-RKIDR--A--------------------------------------------------------------------------------------------------------------------------------------S-------------------------------------------------------------------------------------------------------------------------------------------------K----------------RKRV-MLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDL--VPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLAF---------------------
35 PsiBlast_CBE 76.1034%-174 - C5 -3ZPQ ADRB1_MELGA A:[13-298] -------------GMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVR-G--T--WLWGSFLCELWTSLDVLCVT-ASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH-WWRDEDP-----QALKCYQDPGC-CDF--VTNRAYAIASSIISFYI----PLLIMIFVALRVYREAKEQ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDL--VPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA----------------------
32 PsiBlast_CBE 76.0834%-167 - C5 -3ZPR ADRB1_MELGA B:[13-298] -------------GMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVR-G--T--WLWGSFLCELWTSLDVLCVT-ASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMH-WWRDEDP-----QALKCYQDPGC-CDF--VTNRAYAIASSIISFYI----PLLIMIFVALRVYREAKEQIRKIDRA--S--------------------------------------------------------------------------------------------------------------------------------------K-------------------------------------------------------------------------------------------------------------------------------------------------R----------------KTSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDL--VPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLL-----------------------
80 HHSearch 75.8630%-149 - C5 -3RZE ENLYS_BPT4 (first) A:[10-442] ----------PLVVVLSTICLVT---VGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPM-NILYLL-MSKW--SLG--RPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKY---RTKTRASATILGAWFLSFLWVIPI---L-GWNH---------------RREDKCETDFYDVTWFK----VMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEML--RIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSL-------------------------------------------------------------------------------------------------------NAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQ--------------------------------------------TPNRAKRVITTFRTGTWDAYL-HMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNC--CNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHI---------------------