@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : AA2AR_HUMAN: (2016-01-08 )
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Atome Classification :

(31 SA) .........10........20.-.......30........40........50........60.....---..--.70........80........90........100.......110.......120.......130.......-140-.......150.....-..160.......170.......180.......190.......200.......210.....---------------------------------------------------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------------------------------------------------------------------------------.220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MPIMGSSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQPKEGKNHSQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
68 HHSearch 97.3996%-196 - C5 -3EML ENLYS_BPT4 A:[20-472] ----GSSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQ-------SQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTW--------------------------------------------------------------------------------------------------------------------------------------------------DAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 89.4397%-190 - C5 -2YDV ? A:[3-320] --IMGSSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAI---ST--GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQPKEGKAHSQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQ-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------STLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYFQ---------------------------------------------------------------------------------------
2 PsiBlast_PDB 89.2499%-200 - C5 -3VGA AA2AR_HUMAN A:[6-308] -----SSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQ-------SQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVL--------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 88.9697%-190 - C5 -4UHR AA2AR_HUMAN A:[6-319] -----SSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAI---ST--GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQPKEGKA----GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDC-HAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAA---------------------------------------------------------------------------------------------
3 PsiBlast_PDB 88.6497%-190 - C5 -2YDO ? A:[6-320] -----SSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAI---ST--GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQPKEGKAHSQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMES---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYF----------------------------------------------------------------------------------------
1 PsiBlast_PDB 88.3999%-199 - C5 -3VG9 ? A:[6-309] -----SSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQ-------SQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR-------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 88.1697%-198 - C5 -3UZC AA2AR_HUMAN A:[7-305] ------SVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTP-MLG-WNNCGQP---------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-----------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 87.7697%-196 - C5 -3REY AA2AR_HUMAN A:[7-305] ------SVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTP-MLG-WNNCGQP---------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-----------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 87.7297%-200 - C5 -3UZA AA2AR_HUMAN A:[7-305] ------SVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTP-MLG-WNNCGQP---------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-----------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 87.7197%-198 - C5 -3PWH ? A:[7-305] ------SVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTP-MLG-WNNCGQP---------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-----------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 87.3997%-195 - C5 -3RFM AA2AR_HUMAN A:[7-305] ------SVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTP-MLG-WNNCGQP---------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLP---------------------------------------------------------------------------------------------------------------------------------------------------G--------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-----------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 85.8997%-205 - C5 -4UG2 ? B:[6-305] -----SSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAI---ST--GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCG------------------ACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQM------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRS-----------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 85.8597%-198 - C5 -4UG2 ? A:[6-309] -----SSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAI---ST--GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQPKEGKAHSQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR-------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 71.6790%-174 - C5 -4EIY AA2AR_HUMAN (first) A:[27-258] -PIMGSSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQPKEGKNHSQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLADLEDNWET---------------------------------------------------------------------------------------------------------------------------------------------------L--------------------------------------------------------------------------------------------------------------------------------------------------NDNLKVIEKADNAAQVKDALTKMRAAALDAQKMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHV------------------------
75 HHSearch 71.0231%-163 * C5 *2RH1 ADRB2_HUMAN (first) A:[41-477] ------VGMGIVMSLIVLAIVF-GNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAH---ILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLP-IQMHWYRATHQ-----EAI-NCYAE-ETCCDFFT--NQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEMLRID---------------------------------------------------------------------------------------------------------------------------------------------------EGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNL--IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL-----------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 69.7889%-188 - C5 -3EML ENLYS_BPT4 A:[18-251] --IMGSSVYITVELAIAVLAIL-GNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITI---ST--GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTP-MLG-WNNCGQ-------SQ-GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLNIFEMLRI----------------------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------------------------------------------------------------------------------------------------EGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSH