@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : AA2BR_HUMAN: (2016-01-08 )
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL

Atome Classification :

(33 SA) .........10........20........30........40........50........60........-------70........80........90........100.......110.......120.......130.......140--.......150.......160.....---..170.......180.......190.......200.......---210.......----220-----------------------------------------------------------------------------------------------------------------------------------------------------.........230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISL-------GFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFL--GWNSKDSATNNCTEPWDGTTNESCC---LVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVA---CRQLQRTELM----D-------------------------------------------------------------------------------------------------------------------------------------------------------HSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL
74 HHSearch 92.4062%-171 - C2 -3EML ENLYS_BPT4 A:[21-472] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GWNNCGQ-SQGCGEGQ-------------VACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLNIFEML----RIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDC-SHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQ--------------------
8 PsiBlast_PDB 91.9858%-176 - C2 -3REY AA2AR_HUMAN A:[7-305] -------SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPML--GW-------NNCGQP--------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-------------------------
7 PsiBlast_PDB 91.6958%-175 - C2 -3PWH ? A:[7-305] -------SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPML--GW-------NNCGQP--------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-------------------------
10 PsiBlast_PDB 91.6658%-176 - C2 -3UZA AA2AR_HUMAN A:[7-305] -------SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPML--GW-------NNCGQP--------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-------------------------
11 PsiBlast_PDB 91.4658%-177 - C2 -3UZC AA2AR_HUMAN A:[7-305] -------SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPML--GW-------NNCGQP--------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-------------------------
4 PsiBlast_PDB 91.3459%-177 - C2 -2YDV ? A:[6-312] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAIST-------GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLKQMESQ---------------------------------------------------------------------------------------------------------------------------------------------------------------STLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYFQ-----
9 PsiBlast_PDB 91.2758%-176 - C2 -3RFM AA2AR_HUMAN A:[7-305] -------SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPML--GW-------NNCGQP--------GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS-------------------------
3 PsiBlast_PDB 91.1959%-174 - C2 -2YDO ? A:[6-312] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAIST-------GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLKQMES-----------------------------------------------------------------------------------------------------------------------------------------------------------------TLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAENLYF------
21 PsiBlast_CBE 91.0359%-182 - C2 -4UG2 ? B:[6-305] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAIST-------GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCG-----------------ACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLKQM-------E-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRS-------------------------
2 PsiBlast_PDB 90.9260%-174 - C2 -3VGA AA2AR_HUMAN A:[6-308] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCGQ-------SQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVL----------------------
6 PsiBlast_PDB 90.6059%-177 - C2 -4UHR AA2AR_HUMAN A:[6-312] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAIST-------GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCGQPKEGKA---GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DC-HAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAA-----------
5 PsiBlast_PDB 90.5459%-179 - C2 -4UG2 ? A:[6-309] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLAIPFAIAIST-------GFCAACHGCLFIACFVLVLTASSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCGQPKEGKAHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQL-------------------------------------------------------------------------------------------------------------------------------------------------------------------ARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR---------------------
1 PsiBlast_PDB 89.7060%-175 - C2 -3VG9 ? A:[6-309] ------SSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITIST-------GFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPML--GW-------NNCGQ-------SQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAA---RRQLKQMESQPLPGE-------------------------------------------------------------------------------------------------------------------------------------------------------RARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP-DCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR---------------------
44 PsiBlast_CBE 74.1533%-156 - C2 -2VT4 ADRB1_MELGA A:[20-298] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREA---KEQIR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------EHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA--------------------------
23 PsiBlast_CBE 74.0733%-154 - C2 -4AMI ADRB1_MELGA B:[20-299] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREAKEQIRK--------------------------------------------------------------------------------------------------------------------------------------------------------------------SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLL---------------------------
33 PsiBlast_CBE 73.9133%-144 - C2 -2YCZ ADRB1_MELGA B:[20-298] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREA---KEQIRKIDRAS---K-------------------------------------------------------------------------------------------------------------------------------------------------------RKRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLAF-------------------------
34 PsiBlast_CBE 73.8233%-147 - C2 -2YCZ ADRB1_MELGA A:[20-298] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREA---KEQIRKIDRAS---K-------------------------------------------------------------------------------------------------------------------------------------------------------RKRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLAF-------------------------
32 PsiBlast_CBE 73.8233%-154 - C2 -2Y00 ADRB1_MELGA B:[20-300] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREAKEQIRKIDRASKR----K-------------------------------------------------------------------------------------------------------------------------------------------------------TSRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA--------------------------
37 PsiBlast_CBE 73.7733%-144 - C2 -2YCX ADRB1_MELGA B:[20-298] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREA---KEQIRKIDRAS---K-------------------------------------------------------------------------------------------------------------------------------------------------------RKRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA--------------------------
35 PsiBlast_CBE 73.7633%-149 - C2 -2YCY ADRB1_MELGA B:[20-298] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREA---KEQIRKIDRAS---K-------------------------------------------------------------------------------------------------------------------------------------------------------RKRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLAF-------------------------
18 PsiBlast_PDB 73.5133%-159 - C2 -2Y03 ADRB1_MELGA A:[20-300] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREAKEQIR---------------------------------------------------------------------------------------------------------------------------------------------------------------------SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA--------------------------
17 PsiBlast_PDB 73.4833%-159 - C2 -2Y02 ADRB1_MELGA A:[20-300] ---------------LVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLC-----VTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQ------DPGCC---------DFVTNRAYAIASSIISFYI-PLLIMIFVALRVYREAKEQ-----------------------------------------------------------------------------------------------------------------------------------------------------------------------SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVF---NRDLVPDWLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA--------------------------