@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ACKR3_HUMAN: (2016-01-08 )
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

Atome Classification :

(20 SA) .........10........20........30......-.-.40........50........60........70........80........90..-...--...100.......110.......120.......130.......140.......150...---....160.......170.......180.......-190---........200-.........210.......220.......230-----...-----....------------------------------------------------240.------------------------------------------------------------------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------------------------------------------------------------------------------------------------.--------....250.---......---260.......270.......280-.......290.......300------.........310.......320.......330........340.......350.......360------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNM-P-NKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWV-VLT--IPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSS---RKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSA-SN----NETYCRSFY---PEHSIKEWLIGMELVSVVLGFAVPFSIIAVFY-----FLL-----ARAI------------------------------------------------SASS------------------------------------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------------------------------------------------------------------------------------------------------------------Q--------EKHSSRKI---IFSYVV---VFLVCWLPYHVAVLLDIFSILHY-IPFTCRLEHALFTALHVT--------QCLSLVHCCVNPVLYSFINRNYRYELMKAF-IFKYSAKTGLTKLIDASRVSETEYSALEQSTK------------------------------------------------------------------------------------------------------------------------------------------
41 Fugue 94.4228%-161 - C4 -4XNV P2RY1_HUMAN (first) A:[38-382] -----------------SFKCA--------------L-T-KTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLY-VLT--LPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVY-PKSLGR---LKKKNAICISVLVWLIVVVAISPILFYSGTGVR--KN----KTITCYDTT---SDEYLRSYFIYSMCTTVAM-FCVPLVLILGCY-----GLI-----VRALIYKMKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIVCPLCGVGKDQFEEVE------------------------------------------------------------------------------------------------------------------------------------------------------------------E--------------------------------------------------------------------------------------------------------------------------------------------------------------------P--------LRRKSIYL---VIIVLT---VFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVT--------RGLASLNSCVNPILYFLAGDTFRRR--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 93.5529%-160 - C4 -3ODU CXCR4_HUMAN (first) A:[37-498] --------------------------------PCFRE-E-NANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLF-VIT--LPFWAVDAV--ANWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRP---RKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA---D----DRYICDRFY---PNDL---WVVVFQFQHIMVGLILPGIVILSCY-----CII-----ISKL------------------------------------------------SHSG------------------------------------------------------------------------------------------------------------------------------------------------------------------SNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGH--------QKRKALKT---TVILIL---AFFACWLPYYIGISIDSFILLEI-IKQGCEFENTVHKWISIT--------EALAFFHCCLNPILYAFLGAKFKTSAQHAL-TSGRPLEVLFQ---------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 92.1523%-161 - C4 -4MBS CCR5_HUMAN (first) A:[22-366] ---------------------------------CQKI-N-VKQIAARLLPPLYSLVFIFGFVGNMLVILILINYKRLKSMTDIYLLNLAISDLFF-LLT--VPFW--AHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKA---RTVTFGVVTSVITWVVAVFASLPNIIF--TRSQK-EG----LHYTCSSHF---PYSQYQFWKNFQTLKIVILGLVLPLLVMVICY-----SGI-----LKTLLRMKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLC----GVGK------------------------------------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------------------------------------------------------------------------------------------------------------------QFEEVEEEKKRHRDVRL---IFTIMI---VYFLFWAPYNIVLLLNTFQEFFG-LN-NCSSSNRLDQAMQVT--------ETLGMTHCCINPIIYAFVGEEFRNYLL-VF-FQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 90.3225%-160 - C4 -4XNW RUBR_CLOPA A:[50-382] ---------------------------------------------FYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLY-VLT--LPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGR---LKKKNAICISVLVWLIVVVAISPILFYSGTGVR--KN----KTITCYDTT---SDEYLRSYFI-YSMCTTVAMFCVPLVLILGCY-----GLI-----VRALIYKMKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLC---GVGK------------------------------------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------------------------------------------------------------------------------------------------------------------QFEEV----EEPLRRKS---IYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVT--------RGLASLNSCVNPILYFLAGDTFRRR--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 PsiBlast_PDB 90.1325%-165 - C4 -4XNV P2RY1_HUMAN (first) A:[50-382] ---------------------------------------------FYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLY-VLT--LPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYP-KSLGR---LKKKNAICISVLVWLIVVVAISPILFYSGTGVR--KN----KTITCYDTT---SDEYLRSYFI-YSMCTTVAMFCVPLVLILGCY-----GLI-----VRALIYKMKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIVCPLC-------GVGK------------------------------------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------------------------------------------------------------------------------------------------------------------QFEEV----EEPLRRKS---IYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVT--------RGLASLNSCVNPILYFLAGDTFRRR--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 88.7828%-167 - C4 -4XT3 US28_HCMVA A:[26-310] ---------EDAT------PCVFTDVL---------N-Q-SKPVTL----FLYGVVFLFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLF-VCT--LPLWMQYLLDH-----ASVPCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVK---QACLFS----IFWWIFAVIIAIP---HFMVVTKK-DNQCMTDYDYLEVSY---PIILNVELMLG--------AFVIPLSVISYCY-----YRI-----SRIV------------------------------------------------AVSQ------------------------------------------------------------------------------------------------------------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------------------------------------R--------HKGRIVRV---LIAVVL---VFIIFWLPYHLTLFVDTLKLLKW-ISSSCEFERSLKRALILT--------ESLAFCHCCLNPLLYVFVGTKFRQELHCLL-AE------------------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 85.2228%-161 - C4 -4RWD C562_ECOLX (first) A:[120-399] -------------------------------------------ALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALA-TST--LPFQSAKYLMET-WPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDF---RTPAKAKLINICIWVLASGVGVP--IMVMAVTRP-RD----GAVVCMLQF---PSPSW-YWDTVTKICVFLFAFVVPILIITVCYGLMLLRLR-----SVRL------------------------------------------------LSGS------------------------------------------------------------------------------------------------------------------------------------------------------------------K--------------------------------------------------------------------------------------------------------------------------------------------------------------------E--------KDRSLRRITRMVLVVVG---AFVVCWAPIH------IFVIVWT-LVDIDRRDPLVVAALHLC--------IALGYANSSLNPVLYAFLDENFKRCFRQLC---------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 84.6928%-167 - C4 -4RWA C562_ECOLX (first) A:[120-399] -------------------------------------------ALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALA-TST--LPFQSAKYLMET-WPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDF---RTPAKAKLINICIWVLASGVGVP--IMVMAVTRP-RD----GAVVCMLQF---PSPSW-YWDTVTKICVFLFAFVVPILIITVCYGLMLL--------------------------------------------------------------GS------------------------------------------------------------------------------------------------------------------------------------------------------------------K--------------------------------------------------------------------------------------------------------------------------------------------------------------------E--------KDRSLRRITRMVLVVVG---AFVVCWAPIH------IFVIVWT-LVDIDRRDPLVVAALHLC--------IALGYANSSLNPVLYAFLDENFKRCFRQLC---------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 HHSearch 83.7623%-141 - C4 -2Z73 OPSD_TODPA A:[25-337] ----------------------------------EFD-Q-VPDAVYYSLGIFIGICGIIGCGGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTF-SLVNGFPLMTISCF-LKKWIFGFAACKVYGFIGGIFGFMSIMTMAMISIDRYNVIGRPMAASKK---MSHRRAFIMIIFVWLWSVLWAIGPIFGWGAYTLE--G----VLCNCSFDY---ISRDS--TTRSNILCMFILGFFGPILIIFFCY-----FNI-----VMSV------------------------------------------------SNHEKEMAAMAKRLNAKELRKAQAG---------------------------------------------------------------------------------------------------------------------------------------------A--------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------AEMRLAKI---SIVIVS---QFLLSWSPYAVVALLAQFGPLE----------WVTPYAAQLP--------VMFAKASAIHNPMIYSVSHPKFREAISQTF-PWVLTCCQFDDKETEDDKDAETEIPAGE----------------------------------------------------------------------------------------------------------------------------------------------
11 PsiBlast_PDB 83.7428%-164 - C4 -4N6H C562_ECOLX (first) A:[123-402] -------------------------------------------ALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALA-TST--LPFQSAKYLMET-WPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDF---RTPAKAKLINICIWVLASGVGVP--IMVMAVTRP-RD----GAVVCMLQF---PSPSW-YWDTVTKICVFLFAFVVPILIITVCYGLMLLRLR-----SVRL------------------------------------------------LSGS------------------------------------------------------------------------------------------------------------------------------------------------------------------K--------------------------------------------------------------------------------------------------------------------------------------------------------------------E--------KDRSLRRITRMVLVVVG---AFVVCWAPIH------IFVIVWT-LVDIDRRDPLVVAALHLC--------IALGYANSSLNPVLYAFLDENFKRCFRQLC-RKPCG---------------------------------------------------------------------------------------------------------------------------------------------------------------------
45 Fugue 83.6223%-136 - C4 -3ODU CXCR4_HUMAN (first) A:[37-502] --------------------------------PCFRE-E-NANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLF-VIT--LPFWAVDAVA--NWYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRP---RKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA---D----DRYICDRFY---PN---DLWVVVFQFQHIMVGLILPGIVILSCY-----CII-----ISKL------------------------------------------------SHS--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GSNIFEM---LRIDEG---LRLKIYKDTEGYYTIGIGHLLTK-SPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSGRPLEVLFQ
33 HHSearch 82.9822%-151 * C4 *3PBL DRD3_HUMAN (first) A:[41-472] ------------------------------------------------YALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLV--MPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTT-----G----DPTVCSISN---P---------DFVIYSSVVSFYLPFGVTVLVY-----ARI-----YVVL------------------------------------------------KQRR------------------------------------------------------------------------------------------------------------------------------------------------------------------RKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGVPL--------REKKATQM---VAIVLG---AFIVCWLPFFLTHVLNTHCQTC----------HVSPELYSAT--------TWLGYVNSALNPVIYTTFNIEFRKAFLKIL-SC------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 82.4728%-170 - C4 -4XT1 US28_HCMVA A:[23-310] ------DYDEDAT------PCVFTDVL---------N-Q-SKPVTL----FLYGVVFLFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLF-VCT--LPLWMQYLLD-------SVPCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVK---QACLFS----IFWWIFAVIIAIP---HFMVVTKK-DNQCMTDYDYLEVSY---PIILNVELMLG--------AFVIPLSVISYCY-----YRI-----SRIV------------------------------------------------AVS