@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ACM5_HUMAN: (2016-01-08 )
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP

Atome Classification :

(20 SA) ---.......----..10........20........30........40........50........60........70........80..-......90........100.......110.......120.......130.......140.......150......-.160.......-.170.......180.---....--...--.------190.......200.......210.......220.......230....-...-240...-----....250.......260-.....----...270.......280.......290.......300.......310--.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......--420.......430--------.......440.......450.......460.....---------..470......-..480.......490.......500.......510.......520.......530
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---MEGDSYH----NATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFS-MNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLIS-FIL-WAPAILC-WQYLVGKRTVPL--D---ECQI--QFL--S------EPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSV-TKA-EKRKPA-----HRALFRSCLRCPRPTL--AQRER----NQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDE--DKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLN--PNPSHQMTKRKRV--------VLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTF---------CDK-CVPVTLW-HLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
1 PsiBlast_PDB 94.3342% -63 - C2 -3UON ACM2_HUMAN (first) A:[20-457] ---------------------------------TFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFS-MNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLS-FIL-WAPAILF-WQFIVGVRTVED--G---ECYI--QFF--S------NAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRINIFEMLRIDEGLRLKI-YKDTEG-----YYTIGIGHLLTKSPSLNAAKSEL----DKAI-GRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSL--DAVRRAALINMVFQMGETGVAGFTNSLRMLQQ-------KRWDEAAVNLAKSRWYNQTPNRAKRVITTFR------------------------------TGTWDAY--PPPSRE--------------------KKVTRTILAILLAFIITWAPYNVMVLINTF---------CAP-CIPNTVW-TIGYWLCYINSTINPACYALCNATFKKTFKHLLM---------------------
47 Fugue 77.1421% -55 - C2 -2RH1 ADRB2_HUMAN (first) A:[36-477] --------------------------------DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVS-GLT-SFLPIQMHWYRATHQEAINC--Y---AEETCCDFF--T------NQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEMLRIDEGL-RLK-IYKDTE-----GYYTIGIGHLLTKSPS--LNAAK----SELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRT---------------------------------------------------GTWDAYK--------FCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVI---------QDN-LIRKEVY-ILLNWIGYVNSGFNPLIYCR-SPDFRIAFQELLCL--------------------
3 PsiBlast_PDB 76.0478%-153 - C2 -4U15 ACM3_RAT A:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGG-SGG-DEAEKL-----FNQDVDAAVRGILRNA--KLKPV----YDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNL--AKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTL-----------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 74.4178%-154 - C2 -4DAJ ACM3_RAT (first) D:[10-204] ----------------------------------WQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLR-LKI-YKDTEG-----YYTIGIGHLLTKSPSL--NAAKS----ELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDS--LDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEAAQTLSAILLAFIITWTPYNIMVLVNTFCDSC--IPKTYWNLGYWLC--------YINSTVNPVCYALCNKTFRTTFKTLLL------------------------------------------------------------------------------------
23 PsiBlast_CBE 74.2578%-157 - C2 -4DAJ ACM3_RAT (first) B:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLR-LKI-YKDTEG-----YYTIGIGHLLTKSPSL--NAAKS----ELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDS--LDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEAQTLSAILLAFIITWTPYNIMVLVNTFCDSCI--PKTYWNLGYWLCY--------INSTVNPVCYALCNKTFRTTFKT----------------------------------------------------------------------------------------
25 PsiBlast_CBE 74.0878%-157 - C2 -4U15 ? B:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGG-SGG-DEAEKL-----FNQDVDAAVRGILRNA--KLKPV----YDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNL--AKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLL----------------------------------------------------------------------------------------------------------------------------------------
37 HHSearch 73.9022%-119 - C2 -2Z73 OPSD_TODPA A:[28-333] ------------------------------QVPDAVYYSLGIFIGICGIIGCGGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFLKKWIFGFAACKVYGFIGGIFGFMSIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWS-VLW-AIGPIFG-WGAYTL----EG--V---LCNC--SFDYISRDST--TRSNILCMFILGFFGPILIIFFCYFNIVMSVSNHEKEMAAMAKRL------------------------------------------------------------------------N-------------------------------------------A---K-----------E---------------------------------------------------------------L-------------RKAQA--------GANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQF---------GPLEWVTPYAA-QLPVMFAKASAIHNPMIYSVSHPKFREAISQTFPWVLTCCQFDDKETEDDKDAET
24 PsiBlast_CBE 73.7978%-159 - C2 -4U16 ? B:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGG-SGG-DEAEKL-----FNQDVDAAVRGILRNA--KLKPV----YDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNL--AKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLL----------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 73.5978%-155 - C2 -4DAJ ACM3_RAT (first) A:[9-204] ---------------------------------IWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLR-LKI-YKDTEG-----YYTIGIGHLLTKSPSL--NAAKS----ELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDS--LDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEAQTLSAILLAFIITWTPYNIMVLVNTFCDSCI--PKTYWNLGYWLCY--------INSTVNPVCYALCNKTFRTTFKT----------------------------------------------------------------------------------------
22 PsiBlast_CBE 73.4878%-156 - C2 -4DAJ ACM3_RAT (first) C:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLR-LKI-YKDTEG-----YYTIGIGHLLTKSPSL--NAAKS----ELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDS--LDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEAQTLSAILLAFIITWTPYNIMVLVNTFCDSCI--PKTYWNLGYWLCY--------INSTVNPVCYALCNKTFRTTFKT----------------------------------------------------------------------------------------
48 Fugue 73.4719% -62 - C2 -3ODU CXCR4_HUMAN (first) A:[37-502] -------------------------PCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLF-VIT-LPFWAVDAVAN-WYFGNFLCKAVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPA-LLL-TIPDFIF-ANVSEADDRYIC--D---RFYP--NDL--W------VVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSGSNIFEMLRID---------------------------------------EG----LRLKIYKDTEGYYTIGIGHLLTKS--------------------------PSLNAAKSELDKAIGRNTNGV-ITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEF-ENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSGRPLEVLFQ-----------
4 PsiBlast_PDB 73.2978%-156 - C2 -4U16 ? A:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGG-SGG-DEAEKL-----FNQDVDAAVRGILRNA--KLKPV----YDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNL--AKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCN---------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 72.6878%-155 - C2 -4U14 ENLYS_BPT4 A:[8-204] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVIS-FVL-WAPAILF-WQYFVGKRTVPP--G---ECFI--QFL--S------EPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNCFEMLRIDEGLR-LKI-YKDCEG-----YYTIGIGHLLTKSPSL--NAAKS----ELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDS--LDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQCPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCD--SCIPKTYWNLGYW--------LCYINSTVNPVCYALCNKTFRTTFKTLLL----------------------------------------------------------------------------------
28 HHSearch 70.1365%-147 - C2 -3UON ACM2_HUMAN (first) A:[24-219] -------------------------------------VFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFS-MNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLS-FIL-WAPAILF-WQFIVGVRTVED--G---ECYI--QFF--S------NAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRINIFEMLRIDEGL-RLK-IYKDTE-----GYYTIGIGHLLTKSPS--LNAAK----SELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYD--SLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYPPPSREKKVTRTILAILLAFIITWAPYNVMVLINT--FCAPCIPNTVWTI--------GYWLCYINSTINPACYALCNATFKKTFKHLLM-------------------------------------------------------------------------------
17 PsiBlast_PDB 68.2530%-115 - C2 -2YCW ADRB1_MELGA A:[10-229] ----------------------------------WEA-GMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLV-VPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVS-FLPIMMH-WWRDEDPQALKCYQD---PGCC--DFV--T------NRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIR---------KI-DRA-SKRKRVMLMREHKALKTLGIIMGVFTL--CWLPF----FLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKA--FKRLLAF------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 67.6731%-113 - C2 -4BVN ADRB1_MELGA A:[10-226] ----------------------------------WEA-GMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLV-VPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASVETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVS-FLPIMMH-WWRDEDPQALKCYQD---PGCC--DFV--T------NRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIR-----------------KRKTS-----RVMLMREHKALKTLGI--IMGVF----TLCWLPFFLVNIVNVFNRDLVPKWLFVAFNWLGYANSAMNPIILCR--SPDFRKAFKRLLA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 67.6630%-115 - C2 -2YCZ ADRB1_MELGA A:[10-229] ----------------------------------WEA-GMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLV-VPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVS-FLPIMMH-WWRDEDPQALKCYQD---PGCC--DFV--T------NRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIR---------KI-DRA-SKRKRVMLMREHKALKTLGIIMGVFTL--CWLPF----FLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKA--FKRLLAF------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
51 Fugue 66.2018% -53 - C2 -1F88 OPSD_BOVIN A:[1-348] MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGG-FTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMS-NFRFGENHAIMGVAFTWVMA-LAC-AAPPLVG-WS-----RYIPE--GMQCSCGI--DYY--TPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAASATTQKAEKEV-TRMVIIMVIA-----FLICWLPYAGVAFYIF--THQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPSTTV--SKTETSQVAPA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------