@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ADA1B_HUMAN: (2016-01-08 )
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

Atome Classification :

(27 SA) .........10........20........30........40........50........60........70........80........90........100.....-..110.......120.......130.......140.......150....---...160.......170.......180--.......------190------...-..-..200.........210.......220.......230.......240-------.......--------..------------------------250---------.-----.--------...--------------------------.-.-----.--------.-260----------------..------------------------------.-----------------------.-------------------------------------------------..-----------------------------------------------..--------.--------270---------------.---------.-------..---------....280....--...290.......300.......310........320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.......500.......510.......520
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEV-LGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTL---VTRRKAILALLSVWVLSTVISIGPLL--GWKEPAP------NDD------KEC-GV-TEE--PFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG---------VMKEMSN--------SK------------------------E-----------L-----T--------LRI--------------------------H-S-----K--------N-F------------------HE------------------------------D-----------------------T-------------------------------------------------LS-----------------------------------------------ST--------K--------AK----------------G---------H-------NP---------RSSIAVKLFKF--SREKKAAKTLGIVVGMFILCWLPFF-IALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
56 HHSearch 87.8336%-135 - C7 -2RH1 ADRB2_HUMAN (first) A:[40-477] --------------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHIL-MKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVSGLTSFLPIQM-HWYRATH------QEAINCYAEETCCDF-FTN--QAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLNIFEML---------RIDEGLR--------LKIYKDTEGYYTIGIGHLLTKSPSLNA-----------A-----K--------SEL--------------------------D-KAIGRNTNGVITKDEA-EKLF---------------NQ------------------------------D-----------------------VDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQ-----------------------------------------------QK--------RWDEAAVNLAKSRWYNQ----------TP--------NRAKRVITTF---------RTGTWDAYKFC--LKEHKALKTLGIIMGTFTLCWLPFF-IVNIVHVIQDNL-IRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL-----------------------------------------------------------------------------------------------------------------------------------------------------------
62 HHSearch 87.3036%-137 - C7 -3PBL DRD3_HUMAN (first) A:[41-472] -----------------------------------------------YALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF--GFNTTG--------DP------TVC-SI-SNP---DFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKNIFE---------MLRIDEGLRLKIYKDTE------------------------GYYTIGIGHLLTKSPSLNAAKSELDKAIGR--------------------------NTN-----GVIT-----K-D------------------EAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM-----------------------------------------------LQ-----------------------------------------------QK--------RWDEAAVNLAKSRWYN-----------QTPNRAKRVIT-------TF---------RTGTWDAYGVP--LREKKATQMVAIVLGAFIVCWLPFF-LTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC-----------------------------------------------------------------------------------------------------------------------------------------------------------
59 HHSearch 82.2730%-138 - C7 -3RZE ENLYS_BPT4 (first) A:[9-443] ---------------------------------------------MPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLL-MSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKY---RTKTRASATILGAWFLSFLWVIPIL---GWNH---------RRE------DKC-ET-DFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEML---------RIDEGLR--------LKIYKDTEGYYTIGIGHLLTKSPSLNA-----------A-----K--------SELDKAIGR--------------------N-T-----N--------GVI------------------TK------------------------------D-----------------------E-------------------------------------------------AEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQ--------QKRWDEAAVNLAKSRWYNQ---------T-------PNRAKRVITTFRTGTWDAYLHM--NRERKAAKQLGFIMAAFILCWIPYF-IFFMVIAFCKNC-CNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHI-----------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 78.1830%-148 - C7 -4IAR C562_ECOLX A:[25-398] -------------------------------------------------MLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTV-TGRWTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITDAVEYSAK---RTPKRAAVMIALVWVFSISISLPPFF--WRQA------------------SEC-VVNTDH--ILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIADLEDNWETLNDNLKVIEKADN--------AA------------------------Q-----------V-----K--------DALTKMRAAALDAQKATPPKLEDKSPDSPE-M-----K--------D-FRHGFDILVGQIDDALKLANE------------------------------G-----------------------K-------------------------------------------------VK-----------------------------------------------EA--------Q--------AA----------------A---------E-------QL---------KTTRNAYIQKYLAARERKATKTLGIILGAFIVCWLPFFIISLVMPI-----WFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFK----------------------------------------------------------------------------------------------------------------------------------------------------------
33 PsiBlast_CBE 77.9335%-157 - C7 -2YCW ADRB1_MELGA B:[14-298] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRA--------------SK--------RK------------------------R-----------V-----M--------L------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY-CRSPDFRKAFKRLLAF-----------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 77.4636%-157 - C7 -3ZPQ ADRB1_MELGA B:[14-300] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRA------------------------SK------------------------R-----------K-----T--------SRV--------------------------M----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L--MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY-CRSPDFRKAFKRLLA------------------------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 77.4136%-169 - C7 -2Y02 ADRB1_MELGA A:[14-300] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQ------------------------------------------------------------------------------------SRV--------------------------M----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L--MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY-CRSPDFRKAFKRLLA------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 77.2935%-150 - C7 -4BVN ADRB1_MELGA A:[14-300] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASVETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQIR------------------------------K------------------------R-----------K-----T--------SRV--------------------------M----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L--MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPKWLFVAFNWLGYANSAMNPIIL-CRSPDFRKAFKRLLA------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 77.1136%-168 - C7 -2Y00 ADRB1_MELGA A:[14-300] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQ------------------------------------------------------------------------------------SRV--------------------------M----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L--MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY-CRSPDFRKAFKRLLA------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 77.0736%-166 - C7 -3ZPR ADRB1_MELGA A:[14-299] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQ-----------------------------------------------------------------------------------------------------------------M----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L--MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY-CRSPDFRKAFKRLL-------------------------------------------------------------------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 77.0636%-159 - C7 -2Y00 ADRB1_MELGA B:[14-300] -----------------------------------------------MSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVV-RGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDP------GCC-DF-VTN--RAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRA------------------------SK------------------------R-----------K-----T--------SRV--------------------------M----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L--MREHKALKTLGIIMGVFTLCWLPFF-L-VNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIY-CRSPDFRKAFKRLLA------------------------------------------------------------------------------------------------------------------------------------------------------------